Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.00
PubTator Score 0.50

Knowledge Summary

Patent

No data available

Synonym

Accession Q14602
Symbols

Gene

 Compartment GO Term (0)

AA Sequence

MKAFSPVRSIRKNSLLDHRLGISQSKTPVDDLMSLL                                        1 - 36
//

Text Mined References (2)

PMID Year Title
23319000 2014 Genome-wide association study of monoamine metabolite levels in human cerebrospinal fluid.
8224921 1993 Two distinct cDNA sequences encoding the human helix-loop-helix protein Id2.