Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.00
PubTator Score 0.50

Knowledge Summary

Patent

No data available

Synonym

Accession Q14602
Symbols

Gene

PANTHER Protein Class (1)

 GO Component (2)

 Compartment GO Term (0)

AA Sequence

MKAFSPVRSIRKNSLLDHRLGISQSKTPVDDLMSLL                                        1 - 36
//

Text Mined References (2)

PMID Year Title