Property Summary

NCBI Gene PubMed Count 48
PubMed Score 43.39
PubTator Score 44.48

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
ovarian cancer 8492 4.54872854042201E-19
Pick disease 1893 1.21171945974818E-5
group 4 medulloblastoma 1875 1.73926542416798E-4
dermatomyositis 967 3.55409125108745E-4
osteosarcoma 7933 5.70653849348086E-4
Multiple myeloma 1328 6.47242409856431E-4
oligodendroglioma 2849 9.36515109980361E-4
diabetes mellitus 1663 0.00137005651057374
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.0016261340288104
ependymoma 2514 0.00341193441812725
intraductal papillary-mucinous adenoma (IPMA) 2956 0.00661327241511642
Gaucher disease type 1 171 0.00882671131359319
astrocytoma 1493 0.0149566298135659
non primary Sjogren syndrome sicca 840 0.0177036150523076
subependymal giant cell astrocytoma 2287 0.0205729810035092
Waldenstrons macroglobulinemia 765 0.02340156428774
interstitial lung disease 292 0.0246616150979588
Disease Target Count Z-score Confidence
Myofibrillar myopathy 1 6 3.74 1.9

Expression

  Differential Expression (17)

Synonym

Accession Q14596 Q13173 Q15026 Q5J7Q8 Q96GB6 Q9NRF7
Symbols IAI3B
M17S2
MIG19
1A1-3B

Gene

PDB

2MJ5   2L8J   1WJ6   2BKF   2CP8   2G4S   2MGW   4OLE  

  Ortholog (12)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG
Opossum OMA Inparanoid
Chicken OMA EggNOG
Anole lizard OMA Inparanoid
Xenopus OMA EggNOG Inparanoid

Pathway (1)

Gene RIF (18)

PMID Text
26903539 The NBR1 depletion impairs FA turnover and decreases targeting of autophagosomes to FAs, whereas ectopic expression of autophagy-competent, but not autophagy-defective, NBR1 enhances FA disassembly and reduces FA lifetime during migration.
26512954 NBR1 is not required for PARK2-dependent mitophagy.
25043814 NBR1 positively correlates with adipose inflammation in human obese patients.
24879152 Analysis of muscle biopsies of sporadic inclusion body myositis (sIBM) patients revealed a strong decrease of NBR1 phosphorylation in muscles of sIBM patients that directly correlated with the severity of protein aggregation.
24769734 The C-terminal fragments of SQSTM1 and NBR1 exhibited a dominant-negative effect against native SQSTM1/NBR1, probably by competing for LC3 and ubiquitin chain binding.
24692539 structure of the ubiquitin-associated (UBA) domain of human autophagy receptor NBR1 and its interaction with ubiquitin and polyubiquitin
23239026 results suggest that NBR1 is the specific autophagy receptor for pexophagy.
22728060 Autophagy-related NBR1 protein is not involved in the formation/degradation of neuronal intranuclear inclusions in neurodegenerative diseases.
22484440 These findings suggest that NBR1 is involved in the formation of cytoplasmic inclusions in alpha-synucleinopathy.
22430266 Breast and ovarian cancer risk are high in Jewish women with BRCA1 genetic mutation.
21620860 Results indicate that the presence of a tryptophan residue in the LIR motif increases the binding affinity of GABARAPL-1/NBR1-LIR complex.
21606687 AtNBR1 is more similar to mammalian NBR1 than to p62 in domain architecture and amino acid sequence.
21121670 The structural ensemble representing each of the two sequential folding transition transition states of the PB1 domain of NBR1 has been calculated using experimental Phi values and biased molecular dynamics simulations.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19822672 findings suggest a critical function for NBR1 in the regulation of receptor trafficking and provide a mechanism for down-regulation of signaling by Spred2 via NBR1.
19427866 The nbr1 UBA domain binds to lysine-48 and -63 linked polyubiquitin-B chains. Nbr1 also binds to the autophagic effector protein LC3-A via a novel binding site.
19398892 NBR1 together with p62 promotes autophagic degradation of ubiquitinated targets and simultaneously regulates their aggregation when autophagy becomes limited.
11856312 interacts with two proteins; fasciculation and elongation protein zeta-1 (FEZ1), a PKCzeta interacting protein, and calcium and integrin binding protein (CIB), also shows developmentally restricted expression in the neural tube

AA Sequence

MEPQVTLNVTFKNEIQSFLVSDPENTTWADIEAMVKVSFDLNTIQIKYLDEENEEVSINSQGEYEEALKM      1 - 70
AVKQGNQLQMQVHEGHHVVDEAPPPVVGAKRLAARAGKKPLAHYSSLVRVLGSDMKTPEDPAVQSFPLVP     71 - 140
CDTDQPQDKPPDWFTSYLETFREQVVNETVEKLEQKLHEKLVLQNPSLGSCPSEVSMPTSEETLFLPENQ    141 - 210
FSWHIACNNCQRRIVGVRYQCSLCPSYNICEDCEAGPYGHDTNHVLLKLRRPVVGSSEPFCHSKYSTPRL    211 - 280
PAALEQVRLQKQVDKNFLKAEKQRLRAEKKQRKAEVKELKKQLKLHRKIHLWNSIHGLQSPKSPLGRPES    281 - 350
LLQSNTLMLPLQPCTSVMPMLSAAFVDENLPDGTHLQPGTKFIKHWRMKNTGNVKWSADTKLKFMWGNLT    351 - 420
LASTEKKDVLVPCLKAGHVGVVSVEFIAPALEGTYTSHWRLSHKGQQFGPRVWCSIIVDPFPSEESPDNI    421 - 490
EKGMISSSKTDDLTCQQEETFLLAKEERQLGEVTEQTEGTAACIPQKAKNVASERELYIPSVDLLTAQDL    491 - 560
LSFELLDINIVQELERVPHNTPVDVTPCMSPLPHDSPLIEKPGLGQIEEENEGAGFKALPDSMVSVKRKA    561 - 630
ENIASVEEAEEDLSGTQFVCETVIRSLTLDAAPDHNPPCRQKSLQMTFALPEGPLGNEKEEIIHIAEEEA    631 - 700
VMEEEEDEEDEEEEDELKDEVQSQSSASSEDYIIILPECFDTSRPLGDSMYSSALSQPGLERGAEGKPGV    701 - 770
EAGQEPAEAGERLPGGENQPQEHSISDILTTSQTLETVPLIPEVVELPPSLPRSSPCVHHHGSPGVDLPV    771 - 840
TIPEVSSVPDQIRGEPRGSSGLVNSRQKSYDHSRHHHGSSIAGGLVKGALSVAASAYKALFAGPPVTAQP    841 - 910
IISEDQTAALMAHLFEMGFCDRQLNLRLLKKHNYNILQVVTELLQLNNNDWYSQRY                  911 - 966
//

Text Mined References (52)

PMID Year Title
26903539 2016 NBR1 enables autophagy-dependent focal adhesion turnover.
26512954 2015 NBR1 is dispensable for PARK2-mediated mitophagy regardless of the presence or absence of SQSTM1.
26112016 2015 The receptor proteins: pivotal roles in selective autophagy.
25416956 2014 A proteome-scale map of the human interactome network.
25043814 2014 A macrophage NBR1-MEKK3 complex triggers JNK-mediated adipose tissue inflammation in obesity.
24879152 2014 Phosphorylation of NBR1 by GSK3 modulates protein aggregation.
24769734 2014 Dominant-negative function of the C-terminal fragments of NBR1 and SQSTM1 generated during enteroviral infection.
24692539 2014 Solution structure of the ubiquitin-associated (UBA) domain of human autophagy receptor NBR1 and its interaction with ubiquitin and polyubiquitin.
24667779 2014 Functional characterization of BRCA1 gene variants by mini-gene splicing assay.
24664425 2014 ERADication of EDEM1 occurs by selective autophagy and requires deglycosylation by cytoplasmic peptide N-glycanase.
24413169 2014 The non-receptor tyrosine kinase Ack1 regulates the fate of activated EGFR by inducing trafficking to the p62/NBR1 pre-autophagosome.
24269898 2014 p38(MAPK)-regulated induction of p62 and NBR1 after photodynamic therapy promotes autophagic clearance of ubiquitin aggregates and reduces reactive oxygen species levels by supporting Nrf2-antioxidant signaling.
24128730 2013 TRAF6 mediates ubiquitination of KIF23/MKLP1 and is required for midbody ring degradation by selective autophagy.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23239026 2013 NBR1 acts as an autophagy receptor for peroxisomes.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22728060 2012 Autophagy-related proteins (p62, NBR1 and LC3) in intranuclear inclusions in neurodegenerative diseases.
22484440 2012 Autophagic adapter protein NBR1 is localized in Lewy bodies and glial cytoplasmic inclusions and is involved in aggregate formation in ?-synucleinopathy.
22430266 2012 Breast and ovarian cancer risk and risk reduction in Jewish BRCA1/2 mutation carriers.
21989022 2011 A de novo complete BRCA1 gene deletion identified in a Spanish woman with early bilateral breast cancer.
21620860 2011 Characterization of the interaction of GABARAPL-1 with the LIR motif of NBR1.
21606687 2011 Plant NBR1 is a selective autophagy substrate and a functional hybrid of the mammalian autophagic adapters NBR1 and p62/SQSTM1.
21296869 2011 Broad activation of the ubiquitin-proteasome system by Parkin is critical for mitophagy.
21121670 2011 Structural insights into the two sequential folding transition states of the PB1 domain of NBR1 from ? value analysis and biased molecular dynamics simulations.
20808283 2010 NBR1 is a new PB1 signalling adapter in Th2 differentiation and allergic airway inflammation in vivo.
20562859 2010 Network organization of the human autophagy system.
20417604 2010 The selective macroautophagic degradation of aggregated proteins requires the PI3P-binding protein Alfy.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
20010802 2010 Nix is a selective autophagy receptor for mitochondrial clearance.
19946888 2010 Defining the membrane proteome of NK cells.
19822672 2009 Spred2 interaction with the late endosomal protein NBR1 down-regulates fibroblast growth factor receptor signaling.
19427866 2009 Interactions with LC3 and polyubiquitin chains link nbr1 to autophagic protein turnover.
19398892 2009 NBR1 cooperates with p62 in selective autophagy of ubiquitinated targets.
19250911 2009 A role for NBR1 in autophagosomal degradation of ubiquitinated substrates.
16625196 2006 DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage.
16376336 2006 Crystal structure of the PB1 domain of NBR1.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15802564 2005 The kinase domain of titin controls muscle gene expression and protein turnover.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12813044 2003 Interaction codes within the family of mammalian Phox and Bem1p domain-containing proteins.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12107412 2002 Expressed sequence tag analysis of adult human iris for the NEIBank Project: steroid-response factors and similarities with retinal pigment epithelium.
11856312 2002 NBR1 interacts with fasciculation and elongation protein zeta-1 (FEZ1) and calcium and integrin binding protein (CIB) and shows developmentally restricted expression in the neural tube.
11179671 2001 Expression profiles and intergenic structure of head-to-head oriented Brca1 and Nbr1 genes.
8700509 1996 The 5' end of the BRCA1 gene lies within a duplicated region of human chromosome 17q21.
8069304 1994 A novel gene encoding a B-box protein within the BRCA1 region at 17q21.1.
7997258 1994 Regulation of BRCA1.
7584044 1994 Prediction of the coding sequences of unidentified human genes. II. The coding sequences of 40 new genes (KIAA0041-KIAA0080) deduced by analysis of cDNA clones from human cell line KG-1.
7581362 1995 Comparison of the positional cloning methods used to isolate the BRCA1 gene.
7545954 1994 A strong candidate for the breast and ovarian cancer susceptibility gene BRCA1.