Property Summary

NCBI Gene PubMed Count 48
Grant Count 1
R01 Count 1
Funding $79,145.75
PubMed Score 43.39
PubTator Score 44.48

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Synonym

Accession Q14596 Q13173 Q15026 Q5J7Q8 Q96GB6 Q9NRF7
Symbols IAI3B
M17S2
MIG19
1A1-3B

Gene

 Grant Application (1)

PDB

2MJ5   2L8J   1WJ6   2BKF   2CP8   2G4S   2MGW   4OLE  

Gene RIF (18)

PMID Text
26903539 The NBR1 depletion impairs FA turnover and decreases targeting of autophagosomes to FAs, whereas ectopic expression of autophagy-competent, but not autophagy-defective, NBR1 enhances FA disassembly and reduces FA lifetime during migration.
26512954 NBR1 is not required for PARK2-dependent mitophagy.
25043814 NBR1 positively correlates with adipose inflammation in human obese patients.
24879152 Analysis of muscle biopsies of sporadic inclusion body myositis (sIBM) patients revealed a strong decrease of NBR1 phosphorylation in muscles of sIBM patients that directly correlated with the severity of protein aggregation.
24769734 The C-terminal fragments of SQSTM1 and NBR1 exhibited a dominant-negative effect against native SQSTM1/NBR1, probably by competing for LC3 and ubiquitin chain binding.
24692539 structure of the ubiquitin-associated (UBA) domain of human autophagy receptor NBR1 and its interaction with ubiquitin and polyubiquitin
23239026 results suggest that NBR1 is the specific autophagy receptor for pexophagy.
22728060 Autophagy-related NBR1 protein is not involved in the formation/degradation of neuronal intranuclear inclusions in neurodegenerative diseases.
22484440 These findings suggest that NBR1 is involved in the formation of cytoplasmic inclusions in alpha-synucleinopathy.
22430266 Breast and ovarian cancer risk are high in Jewish women with BRCA1 genetic mutation.
More...

AA Sequence

MEPQVTLNVTFKNEIQSFLVSDPENTTWADIEAMVKVSFDLNTIQIKYLDEENEEVSINSQGEYEEALKM      1 - 70
AVKQGNQLQMQVHEGHHVVDEAPPPVVGAKRLAARAGKKPLAHYSSLVRVLGSDMKTPEDPAVQSFPLVP     71 - 140
CDTDQPQDKPPDWFTSYLETFREQVVNETVEKLEQKLHEKLVLQNPSLGSCPSEVSMPTSEETLFLPENQ    141 - 210
FSWHIACNNCQRRIVGVRYQCSLCPSYNICEDCEAGPYGHDTNHVLLKLRRPVVGSSEPFCHSKYSTPRL    211 - 280
PAALEQVRLQKQVDKNFLKAEKQRLRAEKKQRKAEVKELKKQLKLHRKIHLWNSIHGLQSPKSPLGRPES    281 - 350
LLQSNTLMLPLQPCTSVMPMLSAAFVDENLPDGTHLQPGTKFIKHWRMKNTGNVKWSADTKLKFMWGNLT    351 - 420
LASTEKKDVLVPCLKAGHVGVVSVEFIAPALEGTYTSHWRLSHKGQQFGPRVWCSIIVDPFPSEESPDNI    421 - 490
EKGMISSSKTDDLTCQQEETFLLAKEERQLGEVTEQTEGTAACIPQKAKNVASERELYIPSVDLLTAQDL    491 - 560
LSFELLDINIVQELERVPHNTPVDVTPCMSPLPHDSPLIEKPGLGQIEEENEGAGFKALPDSMVSVKRKA    561 - 630
ENIASVEEAEEDLSGTQFVCETVIRSLTLDAAPDHNPPCRQKSLQMTFALPEGPLGNEKEEIIHIAEEEA    631 - 700
VMEEEEDEEDEEEEDELKDEVQSQSSASSEDYIIILPECFDTSRPLGDSMYSSALSQPGLERGAEGKPGV    701 - 770
EAGQEPAEAGERLPGGENQPQEHSISDILTTSQTLETVPLIPEVVELPPSLPRSSPCVHHHGSPGVDLPV    771 - 840
TIPEVSSVPDQIRGEPRGSSGLVNSRQKSYDHSRHHHGSSIAGGLVKGALSVAASAYKALFAGPPVTAQP    841 - 910
IISEDQTAALMAHLFEMGFCDRQLNLRLLKKHNYNILQVVTELLQLNNNDWYSQRY                  911 - 966
//

Text Mined References (52)

PMID Year Title
26903539 2016 NBR1 enables autophagy-dependent focal adhesion turnover.
26512954 2015 NBR1 is dispensable for PARK2-mediated mitophagy regardless of the presence or absence of SQSTM1.
26112016 2015 The receptor proteins: pivotal roles in selective autophagy.
25416956 2014 A proteome-scale map of the human interactome network.
25043814 2014 A macrophage NBR1-MEKK3 complex triggers JNK-mediated adipose tissue inflammation in obesity.
24879152 2014 Phosphorylation of NBR1 by GSK3 modulates protein aggregation.
24769734 2014 Dominant-negative function of the C-terminal fragments of NBR1 and SQSTM1 generated during enteroviral infection.
24692539 2014 Solution structure of the ubiquitin-associated (UBA) domain of human autophagy receptor NBR1 and its interaction with ubiquitin and polyubiquitin.
24667779 2014 Functional characterization of BRCA1 gene variants by mini-gene splicing assay.
24664425 2014 ERADication of EDEM1 occurs by selective autophagy and requires deglycosylation by cytoplasmic peptide N-glycanase.
More...