Property Summary

NCBI Gene PubMed Count 48
PubMed Score 50.49
PubTator Score 44.48

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
astrocytoma 1.200 1.5e-02
dermatomyositis -1.200 3.6e-04
diabetes mellitus -1.100 1.4e-03
ependymoma 1.300 3.4e-03
Gaucher disease type 1 -1.500 8.8e-03
group 4 medulloblastoma 1.600 1.7e-04
interstitial lung disease 1.500 2.5e-02
intraductal papillary-mucinous adenoma (... 1.600 6.6e-03
intraductal papillary-mucinous carcinoma... 1.700 1.6e-03
Multiple myeloma 1.784 6.5e-04
non primary Sjogren syndrome sicca -1.100 1.8e-02
oligodendroglioma 1.400 9.4e-04
osteosarcoma -1.164 5.7e-04
ovarian cancer -2.300 4.5e-19
Pick disease 1.200 1.2e-05
subependymal giant cell astrocytoma -1.491 2.1e-02
Waldenstrons macroglobulinemia 1.389 2.3e-02

Gene RIF (18)

AA Sequence

MEPQVTLNVTFKNEIQSFLVSDPENTTWADIEAMVKVSFDLNTIQIKYLDEENEEVSINSQGEYEEALKM      1 - 70
AVKQGNQLQMQVHEGHHVVDEAPPPVVGAKRLAARAGKKPLAHYSSLVRVLGSDMKTPEDPAVQSFPLVP     71 - 140
CDTDQPQDKPPDWFTSYLETFREQVVNETVEKLEQKLHEKLVLQNPSLGSCPSEVSMPTSEETLFLPENQ    141 - 210
FSWHIACNNCQRRIVGVRYQCSLCPSYNICEDCEAGPYGHDTNHVLLKLRRPVVGSSEPFCHSKYSTPRL    211 - 280
PAALEQVRLQKQVDKNFLKAEKQRLRAEKKQRKAEVKELKKQLKLHRKIHLWNSIHGLQSPKSPLGRPES    281 - 350
LLQSNTLMLPLQPCTSVMPMLSAAFVDENLPDGTHLQPGTKFIKHWRMKNTGNVKWSADTKLKFMWGNLT    351 - 420
LASTEKKDVLVPCLKAGHVGVVSVEFIAPALEGTYTSHWRLSHKGQQFGPRVWCSIIVDPFPSEESPDNI    421 - 490
EKGMISSSKTDDLTCQQEETFLLAKEERQLGEVTEQTEGTAACIPQKAKNVASERELYIPSVDLLTAQDL    491 - 560
LSFELLDINIVQELERVPHNTPVDVTPCMSPLPHDSPLIEKPGLGQIEEENEGAGFKALPDSMVSVKRKA    561 - 630
ENIASVEEAEEDLSGTQFVCETVIRSLTLDAAPDHNPPCRQKSLQMTFALPEGPLGNEKEEIIHIAEEEA    631 - 700
VMEEEEDEEDEEEEDELKDEVQSQSSASSEDYIIILPECFDTSRPLGDSMYSSALSQPGLERGAEGKPGV    701 - 770
EAGQEPAEAGERLPGGENQPQEHSISDILTTSQTLETVPLIPEVVELPPSLPRSSPCVHHHGSPGVDLPV    771 - 840
TIPEVSSVPDQIRGEPRGSSGLVNSRQKSYDHSRHHHGSSIAGGLVKGALSVAASAYKALFAGPPVTAQP    841 - 910
IISEDQTAALMAHLFEMGFCDRQLNLRLLKKHNYNILQVVTELLQLNNNDWYSQRY                  911 - 966
//

Text Mined References (52)

PMID Year Title