Property Summary

NCBI Gene PubMed Count 19
PubMed Score 18.11
PubTator Score 18.87

Knowledge Summary


No data available


  Disease Sources (1)

Disease Target Count P-value
malignant mesothelioma 3163 8.34842208176035E-10
ovarian cancer 8492 4.35574656788021E-6
glioblastoma 5572 2.90543971092692E-5
tuberculosis 1563 4.17392963800313E-5
posterior fossa group B ependymoma 1530 6.13252781430129E-5
atypical teratoid/rhabdoid tumor 1095 1.44029445025913E-4
group 3 medulloblastoma 2254 1.61732159191561E-4
psoriasis 6685 6.89267603650562E-4
osteosarcoma 7933 0.00796125580366268
primitive neuroectodermal tumor 3031 0.0155045684409098
lung cancer 4473 0.0324022761220509
spina bifida 1064 0.0492166780157974


  Differential Expression (12)

Disease log2 FC p
malignant mesothelioma -5.300 0.000
psoriasis -1.400 0.001
osteosarcoma -1.260 0.008
glioblastoma 1.100 0.000
group 3 medulloblastoma 1.900 0.000
primitive neuroectodermal tumor 1.100 0.016
tuberculosis -1.400 0.000
lung cancer 1.300 0.032
atypical teratoid/rhabdoid tumor 1.100 0.000
posterior fossa group B ependymoma 1.100 0.000
spina bifida -1.205 0.049
ovarian cancer -1.300 0.000


Accession Q14587 Q8TDG8 Q96RH4 Q9BZJ9
Symbols HZF3



2EL4   2EL5   2EL6   2EM1   2EMV   2EMW   2EMX   2EMY   2EN0   2EN6   2EN7   2EOF   2EOG   2EOI   2EOJ   2EOK   2EOL   2EOP   2EPV   2EPW   2EPY   2YTF   2YTQ  

  Ortholog (2)

Species Source
Chimp OMA EggNOG
Dog OMA Inparanoid

Gene RIF (12)

23665872 The nuclear localization activity of KRAB domain is a conserved feature of ZNF268.
23091055 These results reveal a novel role of ZNF268b2 that contributes to cervical carcinogenesis in part through enhancing NF-kappaB signaling.
22235304 ZNF268 is a crucial downstream target and effector of GATA-1
18949428 aberrant alternative splicing of ZNF268 is a potential prognostic factor of and may contribute to human hematological malignancies.
18774934 Results demonstrate that the mammalian gene ZNF268 is regulated by hUpf1 via its promoter.
18677094 results indicate that a spliced form of ZNF268 lacking the KRAB domain is located in the cytosol, where it seems to play a role in TNF-alpha-induced NF-kappaB activation by interacting with the IKK complex.
18375384 HTLV-1 oncoprotein tax represses ZNF268 expression through the cAMP-responsive element-binding
16865230 ZNF268 gene may function as a transcriptional activator in the growth and differentiation of cells in development and/or pathogenesis.
16787922 ZNF268 gene promoter is atypical and requires an intragenic element located within the first exon that mediates the effect of CREB for its activity
16735226 4 alternative transcripts of ZNF268 were detected in the human blood cells.

AA Sequence

QRTHTGEKPCKCTECGKAFCWKSQLIMHQRTHVDDKH                                     911 - 947

Text Mined References (21)

PMID Year Title
23946776 2013 Aberrant expression of ZNF268 alters the growth and migration of ovarian cancer cells.
23665872 2013 Novel activity of KRAB domain that functions to reinforce nuclear localization of KRAB-containing zinc finger proteins by interacting with KAP1.
23091055 2012 The zinc finger protein ZNF268 is overexpressed in human cervical cancer and contributes to tumorigenesis via enhancing NF-?B signaling.
22235304 2012 Knockdown of ZNF268, which is transcriptionally downregulated by GATA-1, promotes proliferation of K562 cells.
18949428 2008 Aberrant alternative splicing of human zinc finger gene ZNF268 in human hematological malignancy.
18774934 2008 The mammalian gene ZNF268 is regulated by hUpf1.
18677094 2008 A splice variant of the C(2)H(2)-type zinc finger protein, ZNF268s, regulates NF-kappaB activation by TNF-alpha.
18375384 2008 Human T-cell leukemia virus type 1 oncoprotein tax represses ZNF268 expression through the cAMP-responsive element-binding protein/activating transcription factor pathway.
16865230 2006 KRAB-containing zinc finger gene ZNF268 encodes multiple alternatively spliced isoforms that contain transcription regulatory domains.
16787922 2006 Transcription of human zinc finger ZNF268 gene requires an intragenic promoter element.