Property Summary

NCBI Gene PubMed Count 8
PubMed Score 3.87
PubTator Score 2.23

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
ovarian cancer 8520 4.6e-09
Pick disease 1894 7.5e-06
osteosarcoma 7950 8.3e-06
chronic lymphosyte leukemia 204 1.2e-03
astrocytic glioma 2597 4.7e-03
glioblastoma 5792 6.6e-03
oligodendroglioma 2850 7.2e-03
group 3 medulloblastoma 4104 7.6e-03
ependymoma 4679 1.2e-02
lung cancer 4740 1.2e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.9

Expression

  Differential Expression (10)

Disease log2 FC p
astrocytic glioma 1.300 4.7e-03
chronic lymphosyte leukemia 1.300 1.2e-03
ependymoma 1.500 1.2e-02
glioblastoma 1.100 6.6e-03
group 3 medulloblastoma 1.100 7.6e-03
lung cancer -1.200 1.2e-02
oligodendroglioma 1.500 7.2e-03
osteosarcoma -2.031 8.3e-06
ovarian cancer -2.000 4.6e-09
Pick disease -1.100 7.5e-06

Gene RIF (5)

AA Sequence

MLENYKNLATVGYQLFKPSLISWLEQEESRTVQRGDFQASEWKVQLKTKELALQQDVLGEPTSSGIQMIG      1 - 70
SHNGGEVSDVKQCGDVSSEHSCLKTHVRTQNSENTFECYLYGVDFLTLHKKTSTGEQRSVFSQCGKAFSL     71 - 140
NPDVVCQRTCTGEKAFDCSDSGKSFINHSHLQGHLRTHNGESLHEWKECGRGFIHSTDLAVRIQTHRSEK    141 - 210
PYKCKECGKGFRYSAYLNIHMGTHTGDNPYECKECGKAFTRSCQLTQHRKTHTGEKPYKCKDCGRAFTVS    211 - 280
SCLSQHMKIHVGEKPYECKECGIAFTRSSQLTEHLKTHTAKDPFECKICGKSFRNSSCLSDHFRIHTGIK    281 - 350
PYKCKDCGKAFTQNSDLTKHARTHSGERPYECKECGKAFARSSRLSEHTRTHTGEKPFECVKCGKAFAIS    351 - 420
SNLSGHLRIHTGEKPFECLECGKAFTHSSSLNNHMRTHSAKKPFTCMECGKAFKFPTCVNLHMRIHTGEK    421 - 490
PYKCKQCGKSFSYSNSFQLHERTHTGEKPYECKECGKAFSSSSSFRNHERRHADERLSA               491 - 549
//

Text Mined References (8)

PMID Year Title