Property Summary

NCBI Gene PubMed Count 8
PubMed Score 3.87
PubTator Score 2.23

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
astrocytic glioma 1.300 0.005
ependymoma 1.500 0.012
oligodendroglioma 1.500 0.007
osteosarcoma -2.031 0.000
chronic lymphosyte leukemia 1.300 0.001
glioblastoma 1.100 0.007
lung cancer -1.200 0.012
group 3 medulloblastoma 1.100 0.008
Pick disease -1.100 0.000
ovarian cancer -2.000 0.000

Gene RIF (5)

PMID Text
21874239 HZF1 plays a role in cell cycle regulation, and may function by enhanceing CDK2 activity by interaction with and inhibition of INCA1.
21468593 MEF2 positively regulates the expression of HZF1.
20601676 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
19763908 Report located the trans-activation domain at amino acid residences 49-197 within the non-zinc finger region of HZF1 and identified three nuclear location signals within the zinc finger region.
16628192 The antisense method and RNA interference assay revealed that repression of the intrinsic expression of HZF1 blocked the hemin-induced erythroid differentiation and reduced the PMA-induced megakaryocytic differentiation of K562 cells.

AA Sequence

MLENYKNLATVGYQLFKPSLISWLEQEESRTVQRGDFQASEWKVQLKTKELALQQDVLGEPTSSGIQMIG      1 - 70
SHNGGEVSDVKQCGDVSSEHSCLKTHVRTQNSENTFECYLYGVDFLTLHKKTSTGEQRSVFSQCGKAFSL     71 - 140
NPDVVCQRTCTGEKAFDCSDSGKSFINHSHLQGHLRTHNGESLHEWKECGRGFIHSTDLAVRIQTHRSEK    141 - 210
PYKCKECGKGFRYSAYLNIHMGTHTGDNPYECKECGKAFTRSCQLTQHRKTHTGEKPYKCKDCGRAFTVS    211 - 280
SCLSQHMKIHVGEKPYECKECGIAFTRSSQLTEHLKTHTAKDPFECKICGKSFRNSSCLSDHFRIHTGIK    281 - 350
PYKCKDCGKAFTQNSDLTKHARTHSGERPYECKECGKAFARSSRLSEHTRTHTGEKPFECVKCGKAFAIS    351 - 420
SNLSGHLRIHTGEKPFECLECGKAFTHSSSLNNHMRTHSAKKPFTCMECGKAFKFPTCVNLHMRIHTGEK    421 - 490
PYKCKQCGKSFSYSNSFQLHERTHTGEKPYECKECGKAFSSSSSFRNHERRHADERLSA               491 - 549
//

Text Mined References (8)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
20601676 2010 Analysis of SNPs with an effect on gene expression identifies UBE2L3 and BCL3 as potential new risk genes for Crohn's disease.
17210253 2007 Sticky fingers: zinc-fingers as protein-recognition motifs.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
7865130 1995 Isolation of cDNA clones for 42 different Krüppel-related zinc finger proteins expressed in the human monoblast cell line U-937.