Property Summary

NCBI Gene PubMed Count 13
PubMed Score 32.58
PubTator Score 21.70

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
lung adenocarcinoma 2716 2.0e-15
malignant mesothelioma 3232 8.1e-07
psoriasis 6694 2.6e-04
osteosarcoma 7950 8.1e-04
Disease Target Count Z-score Confidence
Progressive multifocal leukoencephalopathy 25 5.908 3.0

Expression

  Differential Expression (4)

Disease log2 FC p
lung adenocarcinoma -1.400 2.0e-15
malignant mesothelioma -1.700 8.1e-07
osteosarcoma 1.231 8.1e-04
psoriasis 1.500 2.6e-04

Gene RIF (4)

AA Sequence

MELNSLLILLEAAEYLERRDREAEHGYASVLPFDGDFAREKTKAAGLVRKAPNNRSSHNELEKHRRAKLR      1 - 70
LYLEQLKQLVPLGPDSTRHTTLSLLKRAKVHIKKLEEQDRRALSIKEQLQQEHRFLKRRLEQLSVQSVER     71 - 140
VRTDSTGSAVSTDDSEQEVDIEGMEFGPGELDSVGSSSDADDHYSLQSGTGGDSGFGPHCRRLGRPALS     141 - 209
//

Text Mined References (13)

PMID Year Title