Property Summary

NCBI Gene PubMed Count 13
Grant Count 3
R01 Count 3
Funding $234,265.58
PubMed Score 32.37
PubTator Score 21.70

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
malignant mesothelioma -1.700 0.000
psoriasis 1.500 0.000
osteosarcoma 1.231 0.001
lung adenocarcinoma -1.400 0.000

Gene RIF (4)

PMID Text
22895069 The E3 ligase activity of c-IAP1 was not required for downregulation of Mad4 expression.
16167342 replicative senescence-specific factors may block c-Myc inhibition of Miz-1 activation of hMad4 expression, and the continual presence of hMad4 protein may transcriptionally repress selected c-Myc target genes
15469726 Data suggest that the biological function of the interaction between T-complex protein 10-like and MAD4 may be to maintain the differentiation state in liver cells.
12418961 regulation by a transcriptional repressor complex that contains Miz-1 and c-Myc

AA Sequence

MELNSLLILLEAAEYLERRDREAEHGYASVLPFDGDFAREKTKAAGLVRKAPNNRSSHNELEKHRRAKLR      1 - 70
LYLEQLKQLVPLGPDSTRHTTLSLLKRAKVHIKKLEEQDRRALSIKEQLQQEHRFLKRRLEQLSVQSVER     71 - 140
VRTDSTGSAVSTDDSEQEVDIEGMEFGPGELDSVGSSSDADDHYSLQSGTGGDSGFGPHCRRLGRPALS     141 - 209
//

Text Mined References (13)

PMID Year Title
22895069 2012 Dissecting the complex regulation of Mad4 in glioblastoma multiforme cells.
21988832 2011 Toward an understanding of the protein interaction network of the human liver.
16167342 2005 c-Myc creates an activation loop by transcriptionally repressing its own functional inhibitor, hMad4, in young fibroblasts, a loop lost in replicatively senescent fibroblasts.
15862967 2005 Yeast two-hybrid identification of prostatic proteins interacting with human sex hormone-binding globulin.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15469726 2004 Human liver specific transcriptional factor TCP10L binds to MAD4.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12418961 2003 Mad4 is regulated by a transcriptional repressor complex that contains Miz-1 and c-Myc.
More...