| Tbio | ELAV-like protein 3 |
Binds to AU-rich sequences (AREs) of target mRNAs, including VEGF mRNA. May also bind poly-A tracts via RRM 3 (By similarity). May be involved in neuronal differentiation and maintenance.
A member of the ELAVL protein family, ELAV-like 3 is a neural-specific RNA-binding protein which contains three RNP-type RNA recognition motifs. The observation that ELAVL3 is one of several Hu antigens (neuronal-specific RNA-binding proteins) recognized by the anti-Hu serum antibody present in sera from patients with paraneoplastic encephalomyelitis and sensory neuronopathy (PEM/PSN) suggests it has a role in neurogenesis. Two alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. [provided by RefSeq, Jul 2008]
A member of the ELAVL protein family, ELAV-like 3 is a neural-specific RNA-binding protein which contains three RNP-type RNA recognition motifs. The observation that ELAVL3 is one of several Hu antigens (neuronal-specific RNA-binding proteins) recognized by the anti-Hu serum antibody present in sera from patients with paraneoplastic encephalomyelitis and sensory neuronopathy (PEM/PSN) suggests it has a role in neurogenesis. Two alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. [provided by RefSeq, Jul 2008]
Comments
| Disease | Target Count |
|---|---|
| Polycystic Ovary Syndrome | 335 |
| Disease | Target Count | P-value |
|---|---|---|
| lung carcinoma | 2844 | 1.6043061974053E-44 |
| posterior fossa group B ependymoma | 1530 | 2.56892983153901E-14 |
| juvenile dermatomyositis | 1189 | 4.0487084548022E-7 |
| ovarian cancer | 8492 | 4.35184696563959E-7 |
| psoriasis | 6685 | 5.2791528067652E-4 |
| group 3 medulloblastoma | 2254 | 0.00117887891006424 |
| atypical teratoid / rhabdoid tumor | 4369 | 0.00202090548199797 |
| adult high grade glioma | 2148 | 0.00236439595919411 |
| subependymal giant cell astrocytoma | 2287 | 0.00929743434014164 |
| pilocytic astrocytoma | 3086 | 0.0100431678974039 |
| facioscapulohumeral dystrophy | 286 | 0.0109405265834801 |
| pituitary cancer | 1972 | 0.0175075936114859 |
| glioblastoma | 5572 | 0.0244612141749149 |
| Disease | log2 FC | p |
|---|---|---|
| glioblastoma | -1.900 | 0.024 |
| posterior fossa group B ependymoma | -4.100 | 0.000 |
| atypical teratoid / rhabdoid tumor | -2.700 | 0.002 |
| juvenile dermatomyositis | -1.111 | 0.000 |
| adult high grade glioma | -2.400 | 0.002 |
| group 3 medulloblastoma | -2.500 | 0.001 |
| pilocytic astrocytoma | -1.200 | 0.010 |
| subependymal giant cell astrocytoma | -3.945 | 0.009 |
| lung carcinoma | 2.700 | 0.000 |
| ovarian cancer | -1.600 | 0.000 |
| pituitary cancer | -1.500 | 0.018 |
| psoriasis | 1.100 | 0.001 |
| facioscapulohumeral dystrophy | 2.200 | 0.011 |
| Species | Source |
|---|---|
| Chimp | OMA EggNOG |
| Mouse | OMA EggNOG Inparanoid |
| Rat | OMA EggNOG Inparanoid |
| Dog | OMA EggNOG Inparanoid |
| Horse | OMA EggNOG Inparanoid |
| Cow | OMA EggNOG Inparanoid |
| Pig | OMA EggNOG |
| Opossum | OMA EggNOG Inparanoid |
| Anole lizard | OMA EggNOG Inparanoid |
| Xenopus | OMA EggNOG Inparanoid |
| Zebrafish | OMA EggNOG Inparanoid |
MVTQILGAMESQVGGGPAGPALPNGPLLGTNGATDDSKTNLIVNYLPQNMTQDEFKSLFGSIGDIESCKL 1 - 70 VRDKITGQSLGYGFVNYSDPNDADKAINTLNGLKLQTKTIKVSYARPSSASIRDANLYVSGLPKTMSQKE 71 - 140 MEQLFSQYGRIITSRILVDQVTGVSRGVGFIRFDKRIEAEEAIKGLNGQKPLGAAEPITVKFANNPSQKT 141 - 210 GQALLTHLYQSSARRYAGPLHHQTQRFRLDNLLNMAYGVKSPLSLIARFSPIAIDGMSGLAGVGLSGGAA 211 - 280 GAGWCIFVYNLSPEADESVLWQLFGPFGAVTNVKVIRDFTTNKCKGFGFVTMTNYDEAAMAIASLNGYRL 281 - 350 GERVLQVSFKTSKQHKA 351 - 367 //
| PMID | Year | Title |
|---|---|---|
| 16189514 | 2005 | Towards a proteome-scale map of the human protein-protein interaction network. |
| 15489334 | 2004 | The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). |
| 15057824 | 2004 | The DNA sequence and biology of human chromosome 19. |
| 12477932 | 2002 | Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences. |
| 12209604 | 2002 | Novel products of the HUD, HUC, NNP-1 and alpha-internexin genes identified by autologous antibody screening of a pediatric neuroblastoma library. |
| 10848602 | 2000 | HuD RNA recognition motifs play distinct roles in the formation of a stable complex with AU-rich RNA. |
| 10710437 | 2000 | RNA-binding analyses of HuC and HuD with the VEGF and c-myc 3'-untranslated regions using a novel ELISA-based assay. |
| 10079173 | 1999 | Analysis of the RNA recognition motifs of human neuronal ELAV-like proteins in binding to a cytokine mRNA. |
| 9799595 | 1998 | Localization of HuC (ELAVL3) to chromosome 19p13.2 by fluorescence in situ hybridization utilizing a novel tyramide labeling technique. |
| 7511893 | 1994 | A hippocampal protein associated with paraneoplastic neurologic syndrome and small cell lung carcinoma. |
