Property Summary

NCBI Gene PubMed Count 9
PubMed Score 326.66
PubTator Score 15.15

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count
Polycystic Ovary Syndrome 335
Disease Target Count P-value
lung carcinoma 2844 1.6043061974053E-44
posterior fossa group B ependymoma 1530 2.56892983153901E-14
juvenile dermatomyositis 1189 4.0487084548022E-7
ovarian cancer 8492 4.35184696563959E-7
psoriasis 6685 5.2791528067652E-4
group 3 medulloblastoma 2254 0.00117887891006424
atypical teratoid / rhabdoid tumor 4369 0.00202090548199797
adult high grade glioma 2148 0.00236439595919411
subependymal giant cell astrocytoma 2287 0.00929743434014164
pilocytic astrocytoma 3086 0.0100431678974039
facioscapulohumeral dystrophy 286 0.0109405265834801
pituitary cancer 1972 0.0175075936114859
glioblastoma 5572 0.0244612141749149

Expression

  Differential Expression (13)

Disease log2 FC p
glioblastoma -1.900 0.024
posterior fossa group B ependymoma -4.100 0.000
atypical teratoid / rhabdoid tumor -2.700 0.002
juvenile dermatomyositis -1.111 0.000
adult high grade glioma -2.400 0.002
group 3 medulloblastoma -2.500 0.001
pilocytic astrocytoma -1.200 0.010
subependymal giant cell astrocytoma -3.945 0.009
lung carcinoma 2.700 0.000
ovarian cancer -1.600 0.000
pituitary cancer -1.500 0.018
psoriasis 1.100 0.001
facioscapulohumeral dystrophy 2.200 0.011

Synonym

Accession Q14576 Q16135 Q96CL8 Q96QS9
Symbols HUC
HUCL
PLE21

Gene

  Ortholog (11)

Gene RIF (1)

PMID Text
12209604 HuC expression in neuroblastoma

AA Sequence

MVTQILGAMESQVGGGPAGPALPNGPLLGTNGATDDSKTNLIVNYLPQNMTQDEFKSLFGSIGDIESCKL      1 - 70
VRDKITGQSLGYGFVNYSDPNDADKAINTLNGLKLQTKTIKVSYARPSSASIRDANLYVSGLPKTMSQKE     71 - 140
MEQLFSQYGRIITSRILVDQVTGVSRGVGFIRFDKRIEAEEAIKGLNGQKPLGAAEPITVKFANNPSQKT    141 - 210
GQALLTHLYQSSARRYAGPLHHQTQRFRLDNLLNMAYGVKSPLSLIARFSPIAIDGMSGLAGVGLSGGAA    211 - 280
GAGWCIFVYNLSPEADESVLWQLFGPFGAVTNVKVIRDFTTNKCKGFGFVTMTNYDEAAMAIASLNGYRL    281 - 350
GERVLQVSFKTSKQHKA                                                         351 - 367
//

Text Mined References (10)

PMID Year Title
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15057824 2004 The DNA sequence and biology of human chromosome 19.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12209604 2002 Novel products of the HUD, HUC, NNP-1 and alpha-internexin genes identified by autologous antibody screening of a pediatric neuroblastoma library.
10848602 2000 HuD RNA recognition motifs play distinct roles in the formation of a stable complex with AU-rich RNA.
10710437 2000 RNA-binding analyses of HuC and HuD with the VEGF and c-myc 3'-untranslated regions using a novel ELISA-based assay.
10079173 1999 Analysis of the RNA recognition motifs of human neuronal ELAV-like proteins in binding to a cytokine mRNA.
9799595 1998 Localization of HuC (ELAVL3) to chromosome 19p13.2 by fluorescence in situ hybridization utilizing a novel tyramide labeling technique.
7511893 1994 A hippocampal protein associated with paraneoplastic neurologic syndrome and small cell lung carcinoma.