Property Summary

NCBI Gene PubMed Count 9
Grant Count 29
R01 Count 7
Funding $4,302,504.1
PubMed Score 326.66
PubTator Score 15.15

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
glioblastoma -1.900 0.024
posterior fossa group B ependymoma -4.100 0.000
atypical teratoid / rhabdoid tumor -2.700 0.002
juvenile dermatomyositis -1.111 0.000
adult high grade glioma -2.400 0.002
group 3 medulloblastoma -2.500 0.001
pilocytic astrocytoma -1.200 0.010
subependymal giant cell astrocytoma -3.945 0.009
lung carcinoma 2.700 0.000
ovarian cancer -1.600 0.000
pituitary cancer -1.500 0.018
psoriasis 1.100 0.001
facioscapulohumeral dystrophy 2.200 0.011

Gene RIF (1)

PMID Text
12209604 HuC expression in neuroblastoma

AA Sequence

MVTQILGAMESQVGGGPAGPALPNGPLLGTNGATDDSKTNLIVNYLPQNMTQDEFKSLFGSIGDIESCKL      1 - 70
VRDKITGQSLGYGFVNYSDPNDADKAINTLNGLKLQTKTIKVSYARPSSASIRDANLYVSGLPKTMSQKE     71 - 140
MEQLFSQYGRIITSRILVDQVTGVSRGVGFIRFDKRIEAEEAIKGLNGQKPLGAAEPITVKFANNPSQKT    141 - 210
GQALLTHLYQSSARRYAGPLHHQTQRFRLDNLLNMAYGVKSPLSLIARFSPIAIDGMSGLAGVGLSGGAA    211 - 280
GAGWCIFVYNLSPEADESVLWQLFGPFGAVTNVKVIRDFTTNKCKGFGFVTMTNYDEAAMAIASLNGYRL    281 - 350
GERVLQVSFKTSKQHKA                                                         351 - 367
//

Text Mined References (10)

PMID Year Title
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15057824 2004 The DNA sequence and biology of human chromosome 19.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12209604 2002 Novel products of the HUD, HUC, NNP-1 and alpha-internexin genes identified by autologous antibody screening of a pediatric neuroblastoma library.
10848602 2000 HuD RNA recognition motifs play distinct roles in the formation of a stable complex with AU-rich RNA.
10710437 2000 RNA-binding analyses of HuC and HuD with the VEGF and c-myc 3'-untranslated regions using a novel ELISA-based assay.
10079173 1999 Analysis of the RNA recognition motifs of human neuronal ELAV-like proteins in binding to a cytokine mRNA.
9799595 1998 Localization of HuC (ELAVL3) to chromosome 19p13.2 by fluorescence in situ hybridization utilizing a novel tyramide labeling technique.
7511893 1994 A hippocampal protein associated with paraneoplastic neurologic syndrome and small cell lung carcinoma.