Property Summary

NCBI Gene PubMed Count 9
PubMed Score 369.22
PubTator Score 15.15

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
adult high grade glioma -2.400 2.4e-03
Astrocytoma, Pilocytic -1.200 8.2e-03
atypical teratoid / rhabdoid tumor -2.700 2.0e-03
ependymoma -2.600 3.1e-05
facioscapulohumeral dystrophy 2.200 1.1e-02
glioblastoma -1.500 5.5e-03
group 3 medulloblastoma -2.500 1.2e-03
juvenile dermatomyositis -1.111 4.0e-07
lung carcinoma 2.700 1.6e-44
ovarian cancer -1.600 4.4e-07
pituitary cancer -1.500 1.8e-02
psoriasis 1.100 5.3e-04
subependymal giant cell astrocytoma -3.945 9.3e-03

Gene RIF (1)

AA Sequence

MVTQILGAMESQVGGGPAGPALPNGPLLGTNGATDDSKTNLIVNYLPQNMTQDEFKSLFGSIGDIESCKL      1 - 70
VRDKITGQSLGYGFVNYSDPNDADKAINTLNGLKLQTKTIKVSYARPSSASIRDANLYVSGLPKTMSQKE     71 - 140
MEQLFSQYGRIITSRILVDQVTGVSRGVGFIRFDKRIEAEEAIKGLNGQKPLGAAEPITVKFANNPSQKT    141 - 210
GQALLTHLYQSSARRYAGPLHHQTQRFRLDNLLNMAYGVKSPLSLIARFSPIAIDGMSGLAGVGLSGGAA    211 - 280
GAGWCIFVYNLSPEADESVLWQLFGPFGAVTNVKVIRDFTTNKCKGFGFVTMTNYDEAAMAIASLNGYRL    281 - 350
GERVLQVSFKTSKQHKA                                                         351 - 367
//

Text Mined References (10)

PMID Year Title