Property Summary

NCBI Gene PubMed Count 51
PubMed Score 295.46
PubTator Score 200.25

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.100 4.3e-02
Breast cancer -4.000 3.2e-17
breast carcinoma -1.500 4.3e-18
cystic fibrosis and chronic rhinosinusit... 1.001 1.4e-02
ependymoma 1.200 9.8e-03
esophageal adenocarcinoma -2.900 2.8e-02
interstitial cystitis -1.700 2.3e-02
malignant mesothelioma 2.400 9.1e-07
medulloblastoma, large-cell 1.400 2.2e-02
non-small cell lung cancer 3.459 2.8e-11
ovarian cancer -4.800 4.9e-11

Gene RIF (22)

AA Sequence

MAAAGPRRSVRGAVCLHLLLTLVIFSRAGEACKKVILNVPSKLEADKIIGRVNLEECFRSADLIRSSDPD      1 - 70
FRVLNDGSVYTARAVALSDKKRSFTIWLSDKRKQTQKEVTVLLEHQKKVSKTRHTRETVLRRAKRRWAPI     71 - 140
PCSMQENSLGPFPLFLQQVESDAAQNYTVFYSISGRGVDKEPLNLFYIERDTGNLFCTRPVDREEYDVFD    141 - 210
LIAYASTADGYSADLPLPLPIRVEDENDNHPVFTEAIYNFEVLESSRPGTTVGVVCATDRDEPDTMHTRL    211 - 280
KYSILQQTPRSPGLFSVHPSTGVITTVSHYLDREVVDKYSLIMKVQDMDGQFFGLIGTSTCIITVTDSND    281 - 350
NAPTFRQNAYEAFVEENAFNVEILRIPIEDKDLINTANWRVNFTILKGNENGHFKISTDKETNEGVLSVV    351 - 420
KPLNYEENRQVNLEIGVNNEAPFARDIPRVTALNRALVTVHVRDLDEGPECTPAAQYVRIKENLAVGSKI    421 - 490
NGYKAYDPENRNGNGLRYKKLHDPKGWITIDEISGSIITSKILDREVETPKNELYNITVLAIDKDDRSCT    491 - 560
GTLAVNIEDVNDNPPEILQEYVVICKPKMGYTDILAVDPDEPVHGAPFYFSLPNTSPEISRLWSLTKVND    561 - 630
TAARLSYQKNAGFQEYTIPITVKDRAGQAATKLLRVNLCECTHPTQCRATSRSTGVILGKWAILAILLGI    631 - 700
ALLFSVLLTLVCGVFGATKGKRFPEDLAQQNLIISNTEAPGDDRVCSANGFMTQTTNNSSQGFCGTMGSG    701 - 770
MKNGGQETIEMMKGGNQTLESCRGAGHHHTLDSCRGGHTEVDNCRYTYSEWHSFTQPRLGEKLHRCNQNE    771 - 840
DRMPSQDYVLTYNYEGRGSPAGSVGCCSEKQEEDGLDFLNNLEPKFITLAEACTKR                  841 - 896
//

Text Mined References (52)

PMID Year Title