Property Summary

NCBI Gene PubMed Count 49
Grant Count 78
R01 Count 39
Funding $26,498,682.74
PubMed Score 275.18
PubTator Score 200.25

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q14574 A6NN35 Q14200 Q9HAZ9
Symbols DSC
DSC1
DSC2
DSC4
CDHF3
HT-CP

Gene

PANTHER Protein Class (2)

Gene RIF (20)

PMID Text
26261554 Suggest that Dsc3 can mediate FSH-induced ovarian cancer cell proliferation by activating the EGFR/Akt signaling pathway.
24664224 data suggests that DNA methylation contributes to down-regulation of DSC3 in prostate cancer, and loss of DSC3 predicts poor clinical outcome.
23975055 Low expression of DSC 1, 2, and 3 was observed in 55, 54, and 79 % of liver metastases.
23184149 The data show an important role of physiologically occurring transcript d2-d4 in normal brain function. Interference with this role by DSC3 is a likely pathological mechanism in X-chromosomal dystonia parkinsonism syndrome
22941060 The p53 target gene desmocollin 3 acts as a novel tumor suppressor through inhibiting EGFR/ERK pathway in human lung cancer.
22438068 High expression of desmocollin 1 (DSC1) was observed in 41.6%, DSC2 in 58.0%, DSC3 in 61.4%, E-cadherin in 71.4%, CDX2 in 58.0%, PITX1 in 55.0%, CDK4 in 0.2%, TLE1 in 1.3%, Factor H in 42.5%, and MDM2 in 0.2% of colorectal carcinomas.
22190034 HIV-1 gp160 is identified to have a physical interaction with desmocollin 3 (DSC3) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
21364582 Methylation status of DSC3 DNA is a prognostic marker for colorectal cancer. P53 appears to have an important role in regulating DSC3 expression.
21281804 These findings demonstrate that IgG autoantibodies against an additional component of the desmosomes, Dsc3, induce loss of keratinocyte adhesion and thus may contribute to blister formation in pemphigus.
20952584 Autoimmunity to DSC3 in Pemphigus vulgaris.
More...

AA Sequence

MAAAGPRRSVRGAVCLHLLLTLVIFSRAGEACKKVILNVPSKLEADKIIGRVNLEECFRSADLIRSSDPD      1 - 70
FRVLNDGSVYTARAVALSDKKRSFTIWLSDKRKQTQKEVTVLLEHQKKVSKTRHTRETVLRRAKRRWAPI     71 - 140
PCSMQENSLGPFPLFLQQVESDAAQNYTVFYSISGRGVDKEPLNLFYIERDTGNLFCTRPVDREEYDVFD    141 - 210
LIAYASTADGYSADLPLPLPIRVEDENDNHPVFTEAIYNFEVLESSRPGTTVGVVCATDRDEPDTMHTRL    211 - 280
KYSILQQTPRSPGLFSVHPSTGVITTVSHYLDREVVDKYSLIMKVQDMDGQFFGLIGTSTCIITVTDSND    281 - 350
NAPTFRQNAYEAFVEENAFNVEILRIPIEDKDLINTANWRVNFTILKGNENGHFKISTDKETNEGVLSVV    351 - 420
KPLNYEENRQVNLEIGVNNEAPFARDIPRVTALNRALVTVHVRDLDEGPECTPAAQYVRIKENLAVGSKI    421 - 490
NGYKAYDPENRNGNGLRYKKLHDPKGWITIDEISGSIITSKILDREVETPKNELYNITVLAIDKDDRSCT    491 - 560
GTLAVNIEDVNDNPPEILQEYVVICKPKMGYTDILAVDPDEPVHGAPFYFSLPNTSPEISRLWSLTKVND    561 - 630
TAARLSYQKNAGFQEYTIPITVKDRAGQAATKLLRVNLCECTHPTQCRATSRSTGVILGKWAILAILLGI    631 - 700
ALLFSVLLTLVCGVFGATKGKRFPEDLAQQNLIISNTEAPGDDRVCSANGFMTQTTNNSSQGFCGTMGSG    701 - 770
MKNGGQETIEMMKGGNQTLESCRGAGHHHTLDSCRGGHTEVDNCRYTYSEWHSFTQPRLGEKLHRCNQNE    771 - 840
DRMPSQDYVLTYNYEGRGSPAGSVGCCSEKQEEDGLDFLNNLEPKFITLAEACTKR                  841 - 896
//

Text Mined References (50)

PMID Year Title
26261554 2015 Desmocollin 3 mediates follicle stimulating hormone-induced ovarian epithelial cancer cell proliferation by activating the EGFR/Akt signaling pathway.
24664224 2014 Association of DSC3 mRNA down-regulation in prostate cancer with promoter hypermethylation and poor prognosis.
24221342 2014 Large cell carcinoma of the lung: clinically oriented classification integrating immunohistochemistry and molecular biology.
23975055 2014 The influence of desmocollin 1-3 expression on prognosis after curative resection of colorectal liver metastases.
23946009 2013 Two cases of pemphigus vegetans with IgG anti-desmocollin 3 antibodies.
23897914 2013 A genome-wide association study (GWAS) for bronchopulmonary dysplasia.
23517469 2013 IgA pemphigus with paraneoplastic pemphigus-like clinical features showing IgA antibodies to desmoglein 1/3 and desmocollin 3, and IgG and IgA antibodies to the basement membrane zone.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
23184149 2013 X-linked dystonia parkinsonism syndrome (XDP, lubag): disease-specific sequence change DSC3 in TAF1/DYT3 affects genes in vesicular transport and dopamine metabolism.
23060301 2013 Expression of squamous cell carcinoma markers and adenocarcinoma markers in primary pulmonary neuroendocrine carcinomas.
More...