Property Summary

NCBI Gene PubMed Count 24
Grant Count 1,653
R01 Count 878
Funding $193,762,335.91
PubMed Score 4395.51
PubTator Score 6.99

Knowledge Summary

Patent

No data available

Synonym

Accession Q14568
Symbols HSPCA
HSPCAL3
HSP90AA2
HSP90ALPHA

Gene

PANTHER Protein Class (2)

 GO Function (1)

Gene RIF (20)

PMID Text
26651243 We revealed that Hsp90A and Hsp90B are partly colocalized with heparan sulfate proteoglycans (HSPGs) on the cell surface and that this colocalization was sensitive to heparin.
25287672 Heat shock protein 90 stimulates rat mesenchymal stem cell migration via PI3K/Akt and ERK1/2 pathways
25243181 Studied the serum prolactin, cortisol, and ACTH stress response of intensive care unit (ICU) patients with severe sepsis/septic shock (SS) or systemic inflammatory response syndrome (SIRS) compared to healthy subjects.
25031753 These results indicate that cytoplasmic HSP90alpha may serve as a biomarker for perineural invasion in pancreatic cancer
22935040 Increased expression of nucleated RBC, HSP90alpha and corresponding decreased expression of HO-2 in such hypoxic condition may play a protective role; to prevent cord blood RBC against stress induced damage during preeclampsia.
22753480 Heat shock protein 90alpha is a substrate and chaperone of DNA-PK necessary for the apoptotic response.
22552610 STAT5b pathway regulates Hsp90alpha expression under hypoxic conditions
21519806 HSP90alpha was an IMH-2 epitope-associated protein. Tumor HSP90alpha overexpression was correlated with the metastasis and poor prognosis of colorectal cancer patients.
21127066 extracellular HSP90alpha transactivates EGFR/ErbB1 through TLR4 and a PKCdelta/c-Src pathway, which induces ATP release and cytosolic Ca(2+) increase and finally favors glioblastoma cell migration.
20937816 extracellular Hsp90alpha promotes angiogenesis in an MMP-2-dependent manner.
More...

AA Sequence

MPEETQTQDQPMEEEEVETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNSSDALDKIWYESLTDPSKL      1 - 70
DSGKELHINLIPNKQDQTLTIVDTGIGMTKADLINNLGTIAKSGTKAFMEALQAGADISMIGQFGVSFYS     71 - 140
AYLVAEKVTVITKHNDDEQYAWESSAGGSFTVRTDTGERMGRGTKVILHLKEDQTEYLEEQRIKEIVKKH    141 - 210
SQLIGYPITLFVEKECDKEVSDDETEEKEDKEEEKEKEEKESKDKPEIEDVGSDEEEEKKDGDKKKKKTK    211 - 280
EKYIDQEELNKTKPIWTRNPDDITNEEYGEFCKNLTNDWEDHLAVKHFSVEGQLEFRALLFVP           281 - 343
//

Text Mined References (26)

PMID Year Title
26651243 2015 Cell surface heparan sulfate proteoglycans are involved in the binding of Hsp90? and Hsp90? to the cell plasma membrane.
25287672 2015 Heat shock protein 90 stimulates rat mesenchymal stem cell migration via PI3K/Akt and ERK1/2 pathways.
25243181 2014 Early response roles for prolactin cortisol and circulating and cellular levels of heat shock proteins 72 and 90? in severe sepsis and SIRS.
25031753 2014 Cytoplasmic HSP90? expression is associated with perineural invasion in pancreatic cancer.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
22935040 2013 Differential expression of HSP90? and heme oxygenase in cord blood RBC during preeclampsia.
22753480 2012 Heat shock protein 90? (HSP90?), a substrate and chaperone of DNA-PK necessary for the apoptotic response.
22552610 2012 Hypoxia upregulates Hsp90? expression via STAT5b in cancer cells.
21519806 2011 Identification of heat shock protein 90? as an IMH-2 epitope-associated protein and correlation of its mRNA overexpression with colorectal cancer metastasis and poor prognosis.
21127066 2011 Transactivation of the epidermal growth factor receptor by heat shock protein 90 via Toll-like receptor 4 contributes to the migration of glioblastoma cells.
More...