Property Summary

NCBI Gene PubMed Count 25
PubMed Score 4681.47
PubTator Score 6.99

Knowledge Summary

Patent

No data available

 GWAS Trait (1)

Gene RIF (21)

AA Sequence

MPEETQTQDQPMEEEEVETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNSSDALDKIWYESLTDPSKL      1 - 70
DSGKELHINLIPNKQDQTLTIVDTGIGMTKADLINNLGTIAKSGTKAFMEALQAGADISMIGQFGVSFYS     71 - 140
AYLVAEKVTVITKHNDDEQYAWESSAGGSFTVRTDTGERMGRGTKVILHLKEDQTEYLEEQRIKEIVKKH    141 - 210
SQLIGYPITLFVEKECDKEVSDDETEEKEDKEEEKEKEEKESKDKPEIEDVGSDEEEEKKDGDKKKKKTK    211 - 280
EKYIDQEELNKTKPIWTRNPDDITNEEYGEFCKNLTNDWEDHLAVKHFSVEGQLEFRALLFVP           281 - 343
//

Text Mined References (27)

PMID Year Title