Property Summary

NCBI Gene PubMed Count 62
Grant Count 3
Funding $20,645.67
PubMed Score 79.13
PubTator Score 65.21

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q14566 B2R6H2 Q13504 Q99859
Symbols Mis5
P105MCM
MCG40308

Gene

PDB

2LE8   2KLQ  

 GWAS Trait (1)

Gene RIF (20)

PMID Text
26013954 Methyl(R217)HuR and MCM6 are inversely correlated and are prognostic markers in non small cell lung carcinoma
25661590 Purified MCM4/6/7 complex containing the G364R MCM4 exhibited similar levels of single-stranded DNA binding and ATPase activities to the complex containing wild-type MCM4
25651706 Report presence of homozygous--13910CC genetic variant in the MCM-6 gene upstream from the lactase gene in lactose intolerant patients treated with lactose-restricted diet.
23166591 Expression of HIV-1 Tat upregulates the abundance of minichromosome maintenance complex component 6 (MCM6) in the nucleoli of Jurkat T-cells
22918583 Mcm2-7 loads onto origins during initiation as a double hexamer, yet does not act as a double-stranded DNA pump during elongation.
22190034 Expression of HIV-1 Tat upregulates the abundance of minichromosome maintenance complex component 6 (MCM6) in the nucleoli of Jurkat T-cells
22190034 Expression of HIV-1 Tat upregulates the abundance of minichromosome maintenance complex component 6 (MCM6) in the nucleoli of Jurkat T-cells
21099365 Results indicate that the interaction between hCdt1 and hMcm6 through their interacting domains is key for hCdt1 in facilitating the MCM hetero-hexamer to load onto chromatin for replication licensing.
20628624 Meta-analysis of gene-disease association. (HuGE Navigator)
20508983 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MDLAAAAEPGAGSQHLEVRDEVAEKCQKLFLDFLEEFQSSDGEIKYLQLAEELIRPERNTLVVSFVDLEQ      1 - 70
FNQQLSTTIQEEFYRVYPYLCRALKTFVKDRKEIPLAKDFYVAFQDLPTRHKIRELTSSRIGLLTRISGQ     71 - 140
VVRTHPVHPELVSGTFLCLDCQTVIRDVEQQFKYTQPNICRNPVCANRRRFLLDTNKSRFVDFQKVRIQE    141 - 210
TQAELPRGSIPRSLEVILRAEAVESAQAGDKCDFTGTLIVVPDVSKLSTPGARAETNSRVSGVDGYETEG    211 - 280
IRGLRALGVRDLSYRLVFLACCVAPTNPRFGGKELRDEEQTAESIKNQMTVKEWEKVFEMSQDKNLYHNL    281 - 350
CTSLFPTIHGNDEVKRGVLLMLFGGVPKTTGEGTSLRGDINVCIVGDPSTAKSQFLKHVEEFSPRAVYTS    351 - 420
GKASSAAGLTAAVVRDEESHEFVIEAGALMLADNGVCCIDEFDKMDVRDQVAIHEAMEQQTISITKAGVK    421 - 490
ATLNARTSILAAANPISGHYDRSKSLKQNINLSAPIMSRFDLFFILVDECNEVTDYAIARRIVDLHSRIE    491 - 560
ESIDRVYSLDDIRRYLLFARQFKPKISKESEDFIVEQYKHLRQRDGSGVTKSSWRITVRQLESMIRLSEA    561 - 630
MARMHCCDEVQPKHVKEAFRLLNKSIIRVETPDVNLDQEEEIQMEVDEGAGGINGHADSPAPVNGINGYN    631 - 700
EDINQESAPKASLRLGFSEYCRISNLIVLHLRKVEEEEDESALKRSELVNWYLKEIESEIDSEEELINKK    701 - 770
RIIEKVIHRLTHYDHVLIELTQAGLKGSTEGSESYEEDPYLVVNPNYLLED                       771 - 821
//

Text Mined References (74)

PMID Year Title
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26013954 2015 Methyl(R217)HuR and MCM6 are inversely correlated and are prognostic markers in non small cell lung carcinoma.
25661590 2015 G364R mutation of MCM4 detected in human skin cancer cells affects DNA helicase activity of MCM4/6/7 complex.
25651706 2014 Are there differences between patients with and without the homozygous--13910CC genetic variant in the MCM-6 gene upstream from the lactase gene?--A non-randomised, two armed intervention study without control group.
25416956 2014 A proteome-scale map of the human interactome network.
25036637 2014 A quantitative chaperone interaction network reveals the architecture of cellular protein homeostasis pathways.
24299456 2014 Interaction of human minichromosome maintenance protein-binding protein with minichromosome maintenance 2-7.
23764002 2013 Epidermal growth factor receptor potentiates MCM7-mediated DNA replication through tyrosine phosphorylation of Lyn kinase in human cancers.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22967762 2012 Characterization of O-GlcNAc cycling and proteomic identification of differentially O-GlcNAcylated proteins during G1/S transition.
More...