Property Summary

NCBI Gene PubMed Count 40
Grant Count 85
R01 Count 61
Funding $8,571,678.59
PubMed Score 17.14
PubTator Score 70.38

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q14565 A8K9A2 B4DMW6 Q08AI1 Q99498 Q9UH11
Symbols DMC1H
LIM15
dJ199H16.1

Gene

PDB

1V5W   2ZJB   4HYY  

Gene RIF (28)

PMID Text
26976601 BRCA2 protein stimulates DMC1-mediated DNA strand exchange between RPA-ssDNA complexes and duplex DNA, thus identifying BRCA2 as a mediator of DMC1 recombination function.
26709229 Dmc1 can reject divergent DNA sequences while bypassing a few mismatches in the DNA sequence.
26088134 In contrast to RAD51, stabilization of the presynaptic filament via ATP hydrolysis attenuation is insufficient for enhancement of the DMC1-catalyzed recombination reaction.
23545642 truncated DMC1 octamers further stack with alternate polarity into a filament
23265958 results suggested mutations in the coding sequence of DMC1 are not associated with premature ovarian failure in Chinese women
23182424 conserved lysine in the Walker A motif of hDMC1 is critical for ATP binding.
22156371 The results suggested that PSF may function as an activator for the meiosis-specific recombinase DMC1.
21903585 RAD51-associated protein 1 (RAD51AP1) interacts with the meiotic recombinase DMC1 through a conserved motif.
21307306 RAD51AP1 foci colocalize with a subset of DMC1 foci in spermatocytes.
21151113 D-loops in a human DMC1-driven reaction are substantially more resistant to dissociation by branch-migration proteins such as RAD54 than those formed by RAD51.
More...

AA Sequence

MKEDQVVAEEPGFQDEEESLFQDIDLLQKHGINVADIKKLKSVGICTIKGIQMTTRRALCNVKGLSEAKV      1 - 70
DKIKEAANKLIEPGFLTAFEYSEKRKMVFHITTGSQEFDKLLGGGIESMAITEAFGEFRTGKTQLSHTLC     71 - 140
VTAQLPGAGGYPGGKIIFIDTENTFRPDRLRDIADRFNVDHDAVLDNVLYARAYTSEHQMELLDYVAAKF    141 - 210
HEEAGIFKLLIIDSIMALFRVDFSGRGELAERQQKLAQMLSRLQKISEEYNVAVFVTNQMTADPGATMTF    211 - 280
QADPKKPIGGHILAHASTTRISLRKGRGELRIAKIYDSPEMPENEATFAITAGGIGDAKE              281 - 340
//

Text Mined References (41)

PMID Year Title
26976601 2016 BRCA2 regulates DMC1-mediated recombination through the BRC repeats.
26709229 2016 Tolerance of DNA Mismatches in Dmc1 Recombinase-mediated DNA Strand Exchange.
26088134 2015 Functional Relationship of ATP Hydrolysis, Presynaptic Filament Stability, and Homologous DNA Pairing Activity of the Human Meiotic Recombinase DMC1.
25416956 2014 A proteome-scale map of the human interactome network.
23545642 2013 Structure of a filament of stacked octamers of human DMC1 recombinase.
23265958 2013 Mutations in DMC1 are not responsible for premature ovarian failure in Chinese women.
23182424 2013 Role of the conserved lysine within the Walker A motif of human DMC1.
22899867 2012 Analysis of meiosis regulators in human gonads: a sexually dimorphic spatio-temporal expression pattern suggests involvement of DMRT1 in meiotic entry.
22156371 2012 Human PSF concentrates DNA and stimulates duplex capture in DMC1-mediated homologous pairing.
21903585 2011 RAD51-associated protein 1 (RAD51AP1) interacts with the meiotic recombinase DMC1 through a conserved motif.
More...