Property Summary

NCBI Gene PubMed Count 15
PubMed Score 12.06
PubTator Score 9.21

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
ovarian cancer 8492 2.72365483576698E-4
group 4 medulloblastoma 1875 9.51298671749805E-4
lung cancer 4473 0.0374771110819239
Disease Target Count Z-score Confidence
Hyperuricemia 35 3.992 2.0
Mitral valve stenosis 10 3.185 1.6
Gout 93 3.165 1.6

Expression

  Differential Expression (3)

Disease log2 FC p
lung cancer 1.100 0.037
group 4 medulloblastoma 1.100 0.001
ovarian cancer 1.600 0.000

Synonym

Gene

PANTHER Protein Class (3)

PDB

2C4K  

  Ortholog (13)

AA Sequence

MNAARTGYRVFSANSTAACTELAKRITERLGAELGKSVVYQETNGETRVEIKESVRGQDIFIIQTIPRDV      1 - 70
NTAVMELLIMAYALKTACARNIIGVIPYFPYSKQSKMRKRGSIVCKLLASMLAKAGLTHIITMDLHQKEI     71 - 140
QGFFSFPVDNLRASPFLLQYIQEEIPNYRNAVIVAKSPDAAKRAQSYAERLRLGLAVIHGEAQCTELDMD    141 - 210
DGRHSPPMVKNATVHPGLELPLMMAKEKPPITVVGDVGGRIAIIVDDIIDDVESFVAAAEILKERGAYKI    211 - 280
YVMATHGILSAEAPRLIEESSVDEVVVTNTVPHEVQKLQCPKIKTVDISLILSEAIRRIHNGESMAYLFR    281 - 350
NITVDD                                                                    351 - 356
//

Text Mined References (21)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23263486 2013 Genome-wide association analyses identify 18 new loci associated with serum urate concentrations.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21269460 2011 Initial characterization of the human central proteome.
19447967 2009 Shifted Transversal Design smart-pooling for high coverage interactome mapping.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
More...