Property Summary

NCBI Gene PubMed Count 17
PubMed Score 12.33
PubTator Score 9.21

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
ovarian cancer 8520 2.7e-04
group 4 medulloblastoma 1855 9.5e-04
lung cancer 4740 3.7e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6

Expression

  Differential Expression (3)

Disease log2 FC p
group 4 medulloblastoma 1.100 9.5e-04
lung cancer 1.100 3.7e-02
ovarian cancer 1.600 2.7e-04

AA Sequence

MNAARTGYRVFSANSTAACTELAKRITERLGAELGKSVVYQETNGETRVEIKESVRGQDIFIIQTIPRDV      1 - 70
NTAVMELLIMAYALKTACARNIIGVIPYFPYSKQSKMRKRGSIVCKLLASMLAKAGLTHIITMDLHQKEI     71 - 140
QGFFSFPVDNLRASPFLLQYIQEEIPNYRNAVIVAKSPDAAKRAQSYAERLRLGLAVIHGEAQCTELDMD    141 - 210
DGRHSPPMVKNATVHPGLELPLMMAKEKPPITVVGDVGGRIAIIVDDIIDDVESFVAAAEILKERGAYKI    211 - 280
YVMATHGILSAEAPRLIEESSVDEVVVTNTVPHEVQKLQCPKIKTVDISLILSEAIRRIHNGESMAYLFR    281 - 350
NITVDD                                                                    351 - 356
//

Text Mined References (23)

PMID Year Title