Property Summary

NCBI Gene PubMed Count 16
PubMed Score 16.39
PubTator Score 6.31

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
acute myeloid leukemia -1.100 2.7e-02
adult high grade glioma 1.300 6.8e-04
Astrocytoma, Pilocytic 1.100 7.0e-04
atypical teratoid / rhabdoid tumor 2.200 1.9e-04
ependymoma 1.200 1.3e-02
esophageal adenocarcinoma 1.100 1.8e-02
glioblastoma 1.600 6.8e-07
group 3 medulloblastoma 3.900 6.9e-09
medulloblastoma, large-cell 2.500 4.8e-07
ovarian cancer 2.300 5.1e-06
pancreatic ductal adenocarcinoma liver m... -1.398 5.0e-03
primitive neuroectodermal tumor 1.300 2.2e-03
tuberculosis 1.800 2.5e-07

Protein-protein Interaction (2)

Gene RIF (15)

AA Sequence

MARAGPAWLLLAIWVVLPSWLSSAKVSSLIERISDPKDLKKLLRTRNNVLVLYSKSEVAAENHLRLLSTV      1 - 70
AQAVKGQGTICWVDCGDAESRKLCKKMKVDLSPKDKKVELFHYQDGAFHTEYNRAVTFKSIVAFLKDPKG     71 - 140
PPLWEEDPGAKDVVHLDSEKDFRRLLKKEEKPLLIMFYAPWCSMCKRMMPHFQKAATQLRGHAVLAGMNV    141 - 210
YSSEFENIKEEYSVRGFPTICYFEKGRFLFQYDNYGSTAEDIVEWLKNPQPPQPQVPETPWADEGGSVYH    211 - 280
LTDEDFDQFVKEHSSVLVMFHAPWCGHCKKMKPEFEKAAEALHGEADSSGVLAAVDATVNKALAERFHIS    281 - 350
EFPTLKYFKNGEKYAVPVLRTKKKFLEWMQNPEAPPPPEPTWEEQQTSVLHLVGDNFRETLKKKKHTLVM    351 - 420
FYAPWCPHCKKVIPHFTATADAFKDDRKIACAAVDCVKDKNQDLCQQEAVKGYPTFHYYHYGKFAEKYDS    421 - 490
DRTELGFTNYIRALREGDHERLGKKKEEL                                             491 - 519
//

Text Mined References (21)

PMID Year Title