Property Summary

NCBI Gene PubMed Count 13
PubMed Score 14.60
PubTator Score 6.31

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q14554 D3DN95 Q9BV43
Symbols PDIR

Gene

PDB

4I6X  

Gene RIF (15)

PMID Text
24636989 PDIA5 is a key regulator ATF6alpha-mediated cellular functions in cancer.
24037032 This study demonistrated that Protein disulfide isomerase P5-immunopositive inclusions in patients with Alzheimer's disease.
23206338 PDI is predominantly involved in HIV-1 entry and infection of the T cell line PM-1 and PHA-stimulated primary T lymphocytes, suggesting the preferential use of PDI relevant to the HIV-1 entry and establishment of virus reservoirs in resting CD4+ cells
22230366 PDI is predominantly involved in HIV-1 entry and infection of the T cell line PM-1 and PHA-stimulated primary T lymphocytes, suggesting the preferential use of PDI relevant to the HIV-1 entry and establishment of virus reservoirs in resting CD4+ cells
22190034 PDI is predominantly involved in HIV-1 entry and infection of the T cell line PM-1 and PHA-stimulated primary T lymphocytes, suggesting the preferential use of PDI relevant to the HIV-1 entry and establishment of virus reservoirs in resting CD4+ cells
22002444 protein disulfide isomerase 5 is deregulated in the mucopolysaccharidoses, although the unfolded protein response is not activated
20796029 Protein disulfide isomerases are enzymes that mediate oxidative protein folding in the endoplasmic reticulum.
20458450 PDI is predominantly involved in HIV-1 entry and infection of the T cell line PM-1 and PHA-stimulated primary T lymphocytes, suggesting the preferential use of PDI relevant to the HIV-1 entry and establishment of virus reservoirs in resting CD4+ cells
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
17301129 PDI is predominantly involved in HIV-1 entry and infection of the T cell line PM-1 and PHA-stimulated primary T lymphocytes, suggesting the preferential use of PDI relevant to the HIV-1 entry and establishment of virus reservoirs in resting CD4+ cells
More...

AA Sequence

MARAGPAWLLLAIWVVLPSWLSSAKVSSLIERISDPKDLKKLLRTRNNVLVLYSKSEVAAENHLRLLSTV      1 - 70
AQAVKGQGTICWVDCGDAESRKLCKKMKVDLSPKDKKVELFHYQDGAFHTEYNRAVTFKSIVAFLKDPKG     71 - 140
PPLWEEDPGAKDVVHLDSEKDFRRLLKKEEKPLLIMFYAPWCSMCKRMMPHFQKAATQLRGHAVLAGMNV    141 - 210
YSSEFENIKEEYSVRGFPTICYFEKGRFLFQYDNYGSTAEDIVEWLKNPQPPQPQVPETPWADEGGSVYH    211 - 280
LTDEDFDQFVKEHSSVLVMFHAPWCGHCKKMKPEFEKAAEALHGEADSSGVLAAVDATVNKALAERFHIS    281 - 350
EFPTLKYFKNGEKYAVPVLRTKKKFLEWMQNPEAPPPPEPTWEEQQTSVLHLVGDNFRETLKKKKHTLVM    351 - 420
FYAPWCPHCKKVIPHFTATADAFKDDRKIACAAVDCVKDKNQDLCQQEAVKGYPTFHYYHYGKFAEKYDS    421 - 490
DRTELGFTNYIRALREGDHERLGKKKEEL                                             491 - 519
//

Text Mined References (18)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25416956 2014 A proteome-scale map of the human interactome network.
24636989 2014 Endoplasmic reticulum stress-activated transcription factor ATF6? requires the disulfide isomerase PDIA5 to modulate chemoresistance.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24037032 2014 Protein disulfide isomerase P5-immunopositive inclusions in patients with Alzheimer's disease.
22139419 2011 New gene functions in megakaryopoiesis and platelet formation.
22002444 2012 Unfolded protein response is not activated in the mucopolysaccharidoses but protein disulfide isomerase 5 is deregulated.
21269460 2011 Initial characterization of the human central proteome.
20796029 2010 A structural overview of the PDI family of proteins.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
More...