Property Summary

NCBI Gene PubMed Count 5
Grant Count 4
Funding $362,289.4
PubMed Score 14.84
PubTator Score 5.06

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
osteosarcoma 7,933

Expression

  Differential Expression (1)

Disease log2 FC p
osteosarcoma 1.011 0.000

Gene RIF (1)

PMID Text
16597639 Study reveals the preferential expression of GBX1 by germinal vesicle (GV) oocytes.

AA Sequence

MQRAGGGSAPGGNGGGGGGGPGTAFSIDSLIGPPPPRSGHLLYTGYPMFMPYRPLVLPQALAPAPLPAGL      1 - 70
PPLAPLASFAGRLTNTFCAGLGQAVPSMVALTTALPSFAEPPDAFYGPQELAAAAAAAAATAARNNPEPG     71 - 140
GRRPEGGLEADELLPAREKVAEPPPPPPPHFSETFPSLPAEGKVYSSDEEKLEASAGDPAGSEQEEEGSG    141 - 210
GDSEDDGFLDSSAGGPGALLGPKPKLKGSLGTGAEEGAPVTAGVTAPGGKSRRRRTAFTSEQLLELEKEF    211 - 280
HCKKYLSLTERSQIAHALKLSEVQVKIWFQNRRAKWKRIKAGNVSSRSGEPVRNPKIVVPIPVHVNRFAV    281 - 350
RSQHQQMEQGARP                                                             351 - 363
//

Text Mined References (5)

PMID Year Title
26412852 2015 Comprehensive comparative homeobox gene annotation in human and mouse.
16597639 2006 cDNA cloning and expression of the human NOBOX gene in oocytes and ovarian follicles.
12853948 2003 The DNA sequence of human chromosome 7.
8097731 1993 Expression of a novel human homeobox-containing gene that maps to chromosome 7q36.1 in hematopoietic cells.
7903253 1993 The HOX complex neighbored by the EVX gene, as well as two other homeobox-containing genes, the GBX-class and the EN-class, are located on the same chromosomes 2 and 7 in humans.