Property Summary

NCBI Gene PubMed Count 32
Grant Count 52
R01 Count 32
Funding $5,495,320.67
PubMed Score 115.50
PubTator Score 87.18

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (4)

Disease log2 FC p
malignant mesothelioma 4.700 0.000
osteosarcoma -1.244 0.001
group 3 medulloblastoma -1.700 0.000
ovarian cancer 1.400 0.000

Gene RIF (22)

PMID Text
23639800 Data suggest that SLC29A2 is localized to apical membrane of adult Sertoli cells. In contrast, SLC29A1 is located on basolateral membrane of Sertoli cells; SLC29A1 is primarily responsible for basolateral nucleoside uptake into Sertoli cells.
23590299 these findings reveal the transcriptional repression of ENT1,2 as an innate protective response during acute pulmonary inflammation.
21822668 Data show that ENT1, ENT2, ENT4 and CNT3 protein was detected on ovarian carcinoma cells in all effusions, with expression observed in 1-95% of tumor cells.
21156465 Studies show that ABCC4 and SLC29A2 expression were predictive of achieving CR, and the high expression of GSTP1 suggests that this may be a therapeutic target for relapsed AML.
20392501 Observational study of gene-disease association. (HuGE Navigator)
19297449 This evidence suggested that apical CNT3 and basolateral ENT2 are involved in proximal tubular reabsorption of adenosine and some nucleoside drugs and that apical ENT1 is involved in proximal tubular secretion of 2'-deoxyadenosine.
19105964 HIF-1alpha-dependent repression of ENT2 increases mucosal adenosine signaling and attenuates hypoxia-associated inflammation of the intestine.
18945750 correlation between the recently described p53-inducible apoptosis gene TIGAR and both sensitivity to fludarabine and hENT2 expression in chronic lymphocytic leukemia cells.
18703227 hPMEC from pre-eclampsia exhibit increased total transport (hENT1+hENT2), and maximal velocity (Vmax) for hENT2- (2-fold), but reduced Vmax for hENT1-mediated adenosine transport
18635603 Report expression and hepatobiliary transport characteristics of ENT2 in sandwich-cultured human hepatocytes.
More...

AA Sequence

MARGDAPRDSYHLVGISFFILGLGTLLPWNFFITAIPYFQARLAGAGNSTARILSTNHTGPEDAFNFNNW      1 - 70
VTLLSQLPLLLFTLLNSFLYQCVPETVRILGSLLAILLLFALTAALVKVDMSPGPFFSITMASVCFINSF     71 - 140
SAVLQGSLFGQLGTMPSTYSTLFLSGQGLAGIFAALAMLLSMASGVDAETSALGYFITPCVGILMSIVCY    141 - 210
LSLPHLKFARYYLANKSSQAQAQELETKAELLQSDENGIPSSPQKVALTLDLDLEKEPESEPDEPQKPGK    211 - 280
PSVFTVFQKIWLTALCLVLVFTVTLSVFPAITAMVTSSTSPGKWSQFFNPICCFLLFNIMDWLGRSLTSY    281 - 350
FLWPDEDSRLLPLLVCLRFLFVPLFMLCHVPQRSRLPILFPQDAYFITFMLLFAVSNGYLVSLTMCLAPR    351 - 420
QVLPHEREVAGALMTFFLALGLSCGASLSFLFKALL                                      421 - 456
//

Text Mined References (37)

PMID Year Title
23639800 2013 Basolateral uptake of nucleosides by Sertoli cells is mediated primarily by equilibrative nucleoside transporter 1.
23590299 2013 Repression of the equilibrative nucleoside transporters dampens inflammatory lung injury.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21926972 2011 Large-scale genome-wide association analysis of bipolar disorder identifies a new susceptibility locus near ODZ4.
21822668 2012 Nucleoside transporters are widely expressed in ovarian carcinoma effusions.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21156465 2010 A Phase II trial of gemcitabine and mitoxantrone for patients with acute myeloid leukemia in first relapse.
20392501 2010 Contribution of adenosine related genes to the risk of depression with disturbed sleep.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
More...