Property Summary

NCBI Gene PubMed Count 35
PubMed Score 126.75
PubTator Score 87.18

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
ovarian cancer 8520 2.5e-12
malignant mesothelioma 3232 9.1e-09
group 3 medulloblastoma 4104 6.9e-05
osteosarcoma 7950 1.4e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6

Expression

  Differential Expression (4)

Disease log2 FC p
group 3 medulloblastoma -1.700 6.9e-05
malignant mesothelioma 4.700 9.1e-09
osteosarcoma -1.244 1.4e-03
ovarian cancer 1.400 2.5e-12

Gene RIF (26)

AA Sequence

MARGDAPRDSYHLVGISFFILGLGTLLPWNFFITAIPYFQARLAGAGNSTARILSTNHTGPEDAFNFNNW      1 - 70
VTLLSQLPLLLFTLLNSFLYQCVPETVRILGSLLAILLLFALTAALVKVDMSPGPFFSITMASVCFINSF     71 - 140
SAVLQGSLFGQLGTMPSTYSTLFLSGQGLAGIFAALAMLLSMASGVDAETSALGYFITPCVGILMSIVCY    141 - 210
LSLPHLKFARYYLANKSSQAQAQELETKAELLQSDENGIPSSPQKVALTLDLDLEKEPESEPDEPQKPGK    211 - 280
PSVFTVFQKIWLTALCLVLVFTVTLSVFPAITAMVTSSTSPGKWSQFFNPICCFLLFNIMDWLGRSLTSY    281 - 350
FLWPDEDSRLLPLLVCLRFLFVPLFMLCHVPQRSRLPILFPQDAYFITFMLLFAVSNGYLVSLTMCLAPR    351 - 420
QVLPHEREVAGALMTFFLALGLSCGASLSFLFKALL                                      421 - 456
//

Text Mined References (40)

PMID Year Title