Property Summary

Ligand Count 10
NCBI Gene PubMed Count 27
PubMed Score 71.89
PubTator Score 30.89

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Expression

  Differential Expression (25)

Disease log2 FC p
active Crohn's disease 2.049 1.7e-03
active ulcerative colitis 1.894 8.6e-04
atypical teratoid / rhabdoid tumor 1.300 2.1e-05
Breast cancer 2.000 3.8e-13
breast carcinoma 2.200 1.3e-04
Chronic Lymphocytic Leukemia -1.186 9.6e-04
colon cancer 1.300 4.3e-03
ductal carcinoma in situ 3.000 4.9e-04
ependymoma 1.300 1.4e-08
group 3 medulloblastoma 1.300 1.1e-02
intraductal papillary-mucinous carcinoma... 1.900 2.5e-02
intraductal papillary-mucinous neoplasm ... 1.200 4.8e-03
invasive ductal carcinoma 3.200 8.4e-05
lung cancer 1.200 5.3e-03
malignant mesothelioma 1.200 3.9e-06
medulloblastoma, large-cell 1.300 4.2e-04
non-small cell lung cancer 1.207 6.0e-09
osteosarcoma 2.393 3.6e-04
ovarian cancer 2.900 7.4e-06
pancreatic cancer 1.800 1.5e-05
pancreatic ductal adenocarcinoma liver m... -1.810 2.2e-02
Pick disease -1.300 1.2e-03
primitive neuroectodermal tumor 1.400 2.0e-04
psoriasis 1.200 8.6e-06
Waldenstrons macroglobulinemia -1.170 2.8e-02

Gene RIF (15)

AA Sequence

MWTFLGIATFTYFYKKFGDFITLANREVLLCVLVFLSLGLVLSYRCRHRNGGLLGRQQSGSQFALFSDIL      1 - 70
SGLPFIGFFWAKSPPESENKEQLEARRRRKGTNISETSLIGTAACTSTSSQNDPEVIIVGAGVLGSALAA     71 - 140
VLSRDGRKVTVIERDLKEPDRIVGEFLQPGGYHVLKDLGLGDTVEGLDAQVVNGYMIHDQESKSEVQIPY    141 - 210
PLSENNQVQSGRAFHHGRFIMSLRKAAMAEPNAKFIEGVVLQLLEEDDVVMGVQYKDKETGDIKELHAPL    211 - 280
TVVADGLFSKFRKSLVSNKVSVSSHFVGFLMKNAPQFKANHAELILANPSPVLIYQISSSETRVLVDIRG    281 - 350
EMPRNLREYMVEKIYPQIPDHLKEPFLEATDNSHLRSMPASFLPPSSVKKRGVLLLGDAYNMRHPLTGGG    351 - 420
MTVAFKDIKLWRKLLKGIPDLYDDAAIFEAKKSFYWARKTSHSFVVNILAQALYELFSATDDSLHQLRKA    421 - 490
CFLYFKLGGECVAGPVGLLSVLSPNPLVLIGHFFAVAIYAVYFCFKSEPWITKPRALLSSGAVLYKACSV    491 - 560
IFPLIYSEMKYMVH                                                            561 - 574
//

Text Mined References (31)

PMID Year Title