Property Summary

NCBI Gene PubMed Count 24
Grant Count 6
Funding $2,873,160
PubMed Score 9.63
PubTator Score 53.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
malignant mesothelioma 2.900 0.000
cystic fibrosis 3.748 0.000
lung adenocarcinoma 1.200 0.001
psoriasis -1.400 0.000

Gene RIF (8)

PMID Text
25716425 The analysis of the KRT81rs3660G>C polymorphism may be useful to identify non-small cell lung cancer patients at high risk of a poor disease outcome.
25557232 Novel mutations causing monilethrix are reported in KRT81, KRT83, and KRT86.
24530479 MiRNA-related single nucleotide polymorphism sites of KRT81 is associated with non-Hodgkin's lymphoma.
22539802 Overall survival was significantly longer in multiple myeloma patients with KRT81 rs3660 C/C variant
21799879 KRT81 has emerged as a promising immunohistochemical marker for the identification of squamous cell lung carcinoma
18021261 Transfected p65 induces transcriptional activation of Hb1.
15797458 The KRTHB1 expression uniformly occurred in the midcortex region.
14520698 EBV-dependent upregulation of hHb1-DeltaN in gastric carcinoma cell lines

AA Sequence

MTCGSGFGGRAFSCISACGPRPGRCCITAAPYRGISCYRGLTGGFGSHSVCGGFRAGSCGRSFGYRSGGV      1 - 70
CGPSPPCITTVSVNESLLTPLNLEIDPNAQCVKQEEKEQIKSLNSRFAAFIDKVRFLEQQNKLLETKLQF     71 - 140
YQNRECCQSNLEPLFEGYIETLRREAECVEADSGRLASELNHVQEVLEGYKKKYEEEVSLRATAENEFVA    141 - 210
LKKDVDCAYLRKSDLEANVEALIQEIDFLRRLYEEEILILQSHISDTSVVVKLDNSRDLNMDCIIAEIKA    211 - 280
QYDDIVTRSRAEAESWYRSKCEEMKATVIRHGETLRRTKEEINELNRMIQRLTAEVENAKCQNSKLEAAV    281 - 350
AQSEQQGEAALSDARCKLAELEGALQKAKQDMACLIREYQEVMNSKLGLDIEIATYRRLLEGEEQRLCEG    351 - 420
IGAVNVCVSSSRGGVVCGDLCVSGSRPVTGSVCSAPCNGNVAVSTGLCAPCGQLNTTCGGGSCGVGSCGI    421 - 490
SSLGVGSCGSSCRKC                                                           491 - 505
//

Text Mined References (25)

PMID Year Title
25716425 2015 A genetic variation in microRNA target site of KRT81 gene is associated with survival in early-stage non-small-cell lung cancer.
25557232 2015 Novel KRT83 and KRT86 mutations associated with monilethrix.
25416956 2014 A proteome-scale map of the human interactome network.
24530479 2014 A miR-SNP of the KRT81 gene is associated with the prognosis of non-Hodgkin's lymphoma.
23580065 2013 Shotgun proteomics reveals specific modulated protein patterns in tears of patients with primary open angle glaucoma naïve to therapy.
23088713 2012 Protein interactions of the transcription factor Hoxa1.
22539802 2012 Impact of MiRSNPs on survival and progression in patients with multiple myeloma undergoing autologous stem cell transplantation.
21799879 2011 A dual role for KRT81: a miR-SNP associated with recurrence in non-small-cell lung cancer and a novel marker of squamous cell lung carcinoma.
18021261 2008 Transcriptional activation of a subset of hair keratin genes by the NF-kappaB effector p65/RelA.
16831889 2006 New consensus nomenclature for mammalian keratins.
More...