Property Summary

NCBI Gene PubMed Count 9
PubMed Score 0.08
PubTator Score 258.34

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Carcinoma, Renal Cell 124 0.0 0.0
Disease Target Count
Renal Cell Carcinoma 214
Disease Target Count P-value
psoriasis 6694 1.2e-06
inflammatory breast cancer 286 1.5e-03
lung cancer 4740 6.2e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8

Expression

  Differential Expression (3)

Disease log2 FC p
inflammatory breast cancer -1.100 1.5e-03
lung cancer 1.500 6.2e-03
psoriasis -1.100 1.2e-06

Synonym

Accession Q14532
Symbols HA2
HKA2
hHa2
KRTHA2

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG Inparanoid

AA Sequence

MTSSCCVTNNLQASLKSCPRPASVCSSGVNCRPELCLGYVCQPMACLPSVCLPTTFRPASCLSKTYLSSS      1 - 70
CQAASGISGSMGPGSWYSEGAFNGNEKETMQFLNDRLASYLTRVRQLEQENAELESRIQEASHSQVLTMT     71 - 140
PDYQSHFRTIEELQQKILCTKAENARMVVNIDNAKLAADDFRAKYEAELAMRQLVEADINGLRRILDDLT    141 - 210
LCKADLEAQVESLKEELMCLKKNHEEEVGSLRCQLGDRLNIEVDAAPPVDLTRVLEEMRCQYEAMVEANR    211 - 280
RDVEEWFNMQMEELNQQVATSSEQLQNYQSDIIDLRRTVNTLEIELQAQHSLRDSLENTLTESEARYSSQ    281 - 350
LAQMQCMITNVEAQLAEIRADLERQNQEYQVLLDVRARLEGEINTYRSLLENEDCKLPCNPCSTPSCTTC    351 - 420
VPSPCVPRTVCVPRTVGMPCSPCPQGRY                                              421 - 448
//

Text Mined References (11)

PMID Year Title