Property Summary

NCBI Gene PubMed Count 9
Grant Count 6
R01 Count 6
Funding $259,971.33
PubMed Score 0.08
PubTator Score 258.34

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (3)

Disease log2 FC p
lung cancer 1.500 0.006
inflammatory breast cancer -1.100 0.002
psoriasis -1.100 0.000

Synonym

Accession Q14532
Symbols HA2
HKA2
hHa2
KRTHA2

Gene

AA Sequence

MTSSCCVTNNLQASLKSCPRPASVCSSGVNCRPELCLGYVCQPMACLPSVCLPTTFRPASCLSKTYLSSS      1 - 70
CQAASGISGSMGPGSWYSEGAFNGNEKETMQFLNDRLASYLTRVRQLEQENAELESRIQEASHSQVLTMT     71 - 140
PDYQSHFRTIEELQQKILCTKAENARMVVNIDNAKLAADDFRAKYEAELAMRQLVEADINGLRRILDDLT    141 - 210
LCKADLEAQVESLKEELMCLKKNHEEEVGSLRCQLGDRLNIEVDAAPPVDLTRVLEEMRCQYEAMVEANR    211 - 280
RDVEEWFNMQMEELNQQVATSSEQLQNYQSDIIDLRRTVNTLEIELQAQHSLRDSLENTLTESEARYSSQ    281 - 350
LAQMQCMITNVEAQLAEIRADLERQNQEYQVLLDVRARLEGEINTYRSLLENEDCKLPCNPCSTPSCTTC    351 - 420
VPSPCVPRTVCVPRTVGMPCSPCPQGRY                                              421 - 448
//

Text Mined References (11)

PMID Year Title
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23033978 2012 Diagnostic exome sequencing in persons with severe intellectual disability.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
16831889 2006 New consensus nomenclature for mammalian keratins.
16625196 2006 DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage.
12543931 2002 Toward a human blood serum proteome: analysis by multidimensional separation coupled with mass spectrometry.
10391933 1999 The catalog of human hair keratins. I. Expression of the nine type I members in the hair follicle.
8823373 1996 Genomic characterization of the human type I cuticular hair keratin hHa2 and identification of an adjacent novel type I hair keratin gene hHa5.
7686952 1993 Human hair keratins.
7556444 1995 Sequence data and chromosomal localization of human type I and type II hair keratin genes.
More...