Property Summary

NCBI Gene PubMed Count 47
PubMed Score 62.44
PubTator Score 53.70

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Kidney Neoplasms 37 0.0 0.0
Disease Target Count
Kidney Neoplasm 29
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.1
Disease Target Count Z-score Confidence
Cancer 2499 3.058 1.5

Expression

  Differential Expression (9)

Disease log2 FC p
Breast cancer 1.100 7.5e-06
group 3 medulloblastoma 1.100 4.2e-03
lung adenocarcinoma 1.086 2.9e-05
lung cancer 1.800 3.7e-05
lung carcinoma 1.600 1.3e-23
non-small cell lung cancer 1.394 3.6e-16
ovarian cancer 1.300 3.2e-02
progressive supranuclear palsy -1.500 1.2e-02
psoriasis -1.100 1.6e-02

Gene RIF (34)

AA Sequence

MSWMFKRDPVWKYLQTVQYGVHGNFPRLSYPTFFPRFEFQDVIPPDDFLTSDEEVDSVLFGSLRGHVVGL      1 - 70
RYYTGVVNNNEMVALQRDPNNPYDKNAIKVNNVNGNQVGHLKKELAGALAYIMDNKLAQIEGVVPFGANN     71 - 140
AFTMPLHMTFWGKEENRKAVSDQLKKHGFKLGPAPKTLGFNLESGWGSGRAGPSYSMPVHAAVQMTTEQL    141 - 210
KTEFDKLFEDLKEDDKTHEMEPAEAIETPLLPHQKQALAWMVSRENSKELPPFWEQRNDLYYNTITNFSE    211 - 280
KDRPENVHGGILADDMGLGKTLTAIAVILTNFHDGRPLPIERVKKNLLKKEYNVNDDSMKLGGNNTSEKA    281 - 350
DGLSKDASRCSEQPSISDIKEKSKFRMSELSSSRPKRRKTAVQYIESSDSEEIETSELPQKMKGKLKNVQ    351 - 420
SETKGRAKAGSSKVIEDVAFACALTSSVPTTKKKMLKKGACAVEGSKKTDVEERPRTTLIICPLSVLSNW    421 - 490
IDQFGQHIKSDVHLNFYVYYGPDRIREPALLSKQDIVLTTYNILTHDYGTKGDSPLHSIRWLRVILDEGH    491 - 560
AIRNPNAQQTKAVLDLESERRWVLTGTPIQNSLKDLWSLLSFLKLKPFIDREWWHRTIQRPVTMGDEGGL    561 - 630
RRLQSLIKNITLRRTKTSKIKGKPVLELPERKVFIQHITLSDEERKIYQSVKNEGRATIGRYFNEGTVLA    631 - 700
HYADVLGLLLRLRQICCHTYLLTNAVSSNGPSGNDTPEELRKKLIRKMKLILSSGSDEECAICLDSLTVP    701 - 770
VITHCAHVFCKPCICQVIQNEQPHAKCPLCRNDIHEDNLLECPPEELARDSEKKSDMEWTSSSKINALMH    771 - 840
ALTDLRKKNPNIKSLVVSQFTTFLSLIEIPLKASGFVFTRLDGSMAQKKRVESIQCFQNTEAGSPTIMLL    841 - 910
SLKAGGVGLNLSAASRVFLMDPAWNPAAEDQCFDRCHRLGQKQEVIITKFIVKDSVEENMLKIQNKKREL    911 - 980
AAGAFGTKKPNADEMKQAKINEIRTLIDL                                             981 - 1009
//

Text Mined References (55)

PMID Year Title