Property Summary

NCBI Gene PubMed Count 41
Grant Count 18
R01 Count 6
Funding $2,187,623.6
PubMed Score 58.20
PubTator Score 53.70

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
psoriasis -1.100 0.016
non-small cell lung cancer 1.394 0.000
lung cancer 1.800 0.000
group 3 medulloblastoma 1.100 0.004
lung adenocarcinoma 1.086 0.000
lung carcinoma 1.600 0.000
progressive supranuclear palsy -1.500 0.012
ovarian cancer 1.300 0.032
Breast cancer 1.100 0.000

Gene RIF (26)

PMID Text
26472339 HLTF expression is altered in various cancers via two mechanisms: gene silencing through promoter hypermethylation or alternative mRNA splicing, which leads to the expression of truncated proteins that lack DNA repair domains. [review]
26350214 HLTF promotes the filling-in of gaps left opposite damaged DNA during replication, and this postreplication repair function depends on its HIRAN domain.
26051180 Findings indicate a mechanism of helicase-like transcription factor HLTF-mediated fork reversal and suggest the requirement for distinct fork remodeling activities in the cell.
25858588 These results suggest that the HIRAN domain functions as a sensor to the 3'-end of the primer strand at the stalled replication fork and that the domain facilitates fork regression.
25005870 Study demonstrates a correlation between HLTF expression level and thyroid neoplastic progression where three truncated forms are detected in thyroid carcinoma.
24708595 We were able to provide evidence that methylation of HLTF and especially HPP1 detected in serum is strongly correlated with cell death in CRC using LDH as surrogate marker
22452792 Results demonstrate that loss of HLTF function promotes the malignant transformation of intestinal or colonic adenomas to carcinomas by inducing genomic instability.
21845734 results delineate a previously unknown USP7-HLTF-PCNA molecular network controlling DNA damage response
21795603 HLTF can displace a broad spectrum of proteins such as replication protein A (RPA), PCNA, and replication factor C (RFC), thereby providing the first example for a protein clearing activity at the stalled replication fork.
21396873 HLTF and SHPRH suppress mutagenesis in a damage-specific manner, preventing mutations induced by UV rays and methyl methanesulfonate.
More...

AA Sequence

MSWMFKRDPVWKYLQTVQYGVHGNFPRLSYPTFFPRFEFQDVIPPDDFLTSDEEVDSVLFGSLRGHVVGL      1 - 70
RYYTGVVNNNEMVALQRDPNNPYDKNAIKVNNVNGNQVGHLKKELAGALAYIMDNKLAQIEGVVPFGANN     71 - 140
AFTMPLHMTFWGKEENRKAVSDQLKKHGFKLGPAPKTLGFNLESGWGSGRAGPSYSMPVHAAVQMTTEQL    141 - 210
KTEFDKLFEDLKEDDKTHEMEPAEAIETPLLPHQKQALAWMVSRENSKELPPFWEQRNDLYYNTITNFSE    211 - 280
KDRPENVHGGILADDMGLGKTLTAIAVILTNFHDGRPLPIERVKKNLLKKEYNVNDDSMKLGGNNTSEKA    281 - 350
DGLSKDASRCSEQPSISDIKEKSKFRMSELSSSRPKRRKTAVQYIESSDSEEIETSELPQKMKGKLKNVQ    351 - 420
SETKGRAKAGSSKVIEDVAFACALTSSVPTTKKKMLKKGACAVEGSKKTDVEERPRTTLIICPLSVLSNW    421 - 490
IDQFGQHIKSDVHLNFYVYYGPDRIREPALLSKQDIVLTTYNILTHDYGTKGDSPLHSIRWLRVILDEGH    491 - 560
AIRNPNAQQTKAVLDLESERRWVLTGTPIQNSLKDLWSLLSFLKLKPFIDREWWHRTIQRPVTMGDEGGL    561 - 630
RRLQSLIKNITLRRTKTSKIKGKPVLELPERKVFIQHITLSDEERKIYQSVKNEGRATIGRYFNEGTVLA    631 - 700
HYADVLGLLLRLRQICCHTYLLTNAVSSNGPSGNDTPEELRKKLIRKMKLILSSGSDEECAICLDSLTVP    701 - 770
VITHCAHVFCKPCICQVIQNEQPHAKCPLCRNDIHEDNLLECPPEELARDSEKKSDMEWTSSSKINALMH    771 - 840
ALTDLRKKNPNIKSLVVSQFTTFLSLIEIPLKASGFVFTRLDGSMAQKKRVESIQCFQNTEAGSPTIMLL    841 - 910
SLKAGGVGLNLSAASRVFLMDPAWNPAAEDQCFDRCHRLGQKQEVIITKFIVKDSVEENMLKIQNKKREL    911 - 980
AAGAFGTKKPNADEMKQAKINEIRTLIDL                                             981 - 1009
//

Text Mined References (48)

PMID Year Title
26472339 2016 The helicase-like transcription factor (HLTF) in cancer: loss of function or oncomorphic conversion of a tumor suppressor?
26350214 2015 Human HLTF mediates postreplication repair by its HIRAN domain-dependent replication fork remodelling.
26051180 2015 HLTF's Ancient HIRAN Domain Binds 3' DNA Ends to Drive Replication Fork Reversal.
25858588 2015 Structure of a Novel DNA-binding Domain of Helicase-like Transcription Factor (HLTF) and Its Functional Implication in DNA Damage Tolerance.
25023518 2014 DNA damage-specific deubiquitination regulates Rad18 functions to suppress mutagenesis.
25005870 2014 Helicase-like transcription factor: a new marker of well-differentiated thyroid cancers.
24708595 2014 Circulating cell-free methylated DNA and lactate dehydrogenase release in colorectal cancer.
24129315 2014 Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.
23415230 2013 SMARCA3, a chromatin-remodeling factor, is required for p11-dependent antidepressant action.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
More...