Property Summary

NCBI Gene PubMed Count 54
Grant Count 43
R01 Count 30
Funding $5,186,861.44
PubMed Score 104.03
PubTator Score 91.27

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
cystic fibrosis -1.295 0.000
atypical teratoid / rhabdoid tumor 1.500 0.000
glioblastoma 1.300 0.000
medulloblastoma, large-cell 1.100 0.003
adrenocortical carcinoma -1.051 0.000
primary pancreatic ductal adenocarcinoma 1.378 0.015
tuberculosis -1.200 0.001
pilocytic astrocytoma 1.300 0.001
invasive ductal carcinoma -1.800 0.000

Gene RIF (48)

PMID Text
26510908 Epigenetic silencing of HIC1 promotes epithelial-mesenchymal transition and drives progression in esophageal squamous cell carcinoma via EphA2 signaling.
25934696 The tumor-suppressive function of Hic1 in colon is related to its inhibitory action on proproliferative signaling mediated by the Tlr2 receptor present on tumor cells.
24992983 Results demonstrated an important role of HIC1 for the normal progression of cell cycle, and could affect the homeostasis of p53 as well as number of cell cycle-related genes, which may or may not be directly linked to p53.
24907396 We found that EVI1 and HIC1 colocalize in the nucleus, and their interaction is mediated by the amino terminal zinc finger binding domain of EVI1
24489730 HIC-1 expression was assessed on a tissue microarray containing 80 cases of breast cancer.
24295734 HIC1 silencing in triple-negative breast cancer drives progression through misregulation of LCN2.
24076391 ectopic expression of HIC1 in U2OS and MDA-MB-231 cell lines decreases expression of the ApoER2 and VLDLR genes, encoding two canonical tyrosine kinase receptors for Reelin.
24067369 HIC1 interacts with and modulates the transcriptional activity of STAT3.
23769968 Reactivation of HIC1 suppressed cell migration and induced cell cycle arrest in the G0/G1 phase, as well as induced apoptosis in gastric cancer cells.
23417673 epigenetic HIC1 inactivation, which is an early step in tumorigenesis, could contribute to the accumulation of DNA mutations through impaired DNA repair and thus favor tumorigenesis.
More...

AA Sequence

MTFPEADILLKSGECAGQTMLDTMEAPGHSRQLLLQLNNQRTKGFLCDVIIVVQNALFRAHKNVLAASSA      1 - 70
YLKSLVVHDNLLNLDHDMVSPAVFRLVLDFIYTGRLADGAEAAAAAAVAPGAEPSLGAVLAAASYLQIPD     71 - 140
LVALCKKRLKRHGKYCHLRGGGGGGGGYAPYGRPGRGLRAATPVIQACYPSPVGPPPPPAAEPPSGPEAA    141 - 210
VNTHCAELYASGPGPAAALCASERRCSPLCGLDLSKKSPPGSAAPERPLAERELPPRPDSPPSAGPAAYK    211 - 280
EPPLALPSLPPLPFQKLEEAAPPSDPFRGGSGSPGPEPPGRPDGPSLLYRWMKHEPGLGSYGDELGRERG    281 - 350
SPSERCEERGGDAAVSPGGPPLGLAPPPRYPGSLDGPGAGGDGDDYKSSSEETGSSEDPSPPGGHLEGYP    351 - 420
CPHLAYGEPESFGDNLYVCIPCGKGFPSSEQLNAHVEAHVEEEEALYGRAEAAEVAAGAAGLGPPFGGGG    421 - 490
DKVAGAPGGLGELLRPYRCASCDKSYKDPATLRQHEKTHWLTRPYPCTICGKKFTQRGTMTRHMRSHLGL    491 - 560
KPFACDACGMRFTRQYRLTEHMRIHSGEKPYECQVCGGKFAQQRNLISHMKMHAVGGAAGAAGALAGLGG    561 - 630
LPGVPGPDGKGKLDFPEGVFAVARLTAEQLSLKQQDKAAAAELLAQTTHFLHDPKVALESLYPLAKFTAE    631 - 700
LGLSPDKAAEVLSQGAHLAAGPDGRTIDRFSPT                                         701 - 733
//

Text Mined References (60)

PMID Year Title
26510908 2015 Epigenetic silencing of HIC1 promotes epithelial-mesenchymal transition and drives progression in esophageal squamous cell carcinoma.
25934696 2015 HIC1 Tumor Suppressor Loss Potentiates TLR2/NF-?B Signaling and Promotes Tissue Damage-Associated Tumorigenesis.
24992983 2014 P53 induction accompanying G2/M arrest upon knockdown of tumor suppressor HIC1 in U87MG glioma cells.
24907396 2014 Physical and functional interaction of the proto-oncogene EVI1 and tumor suppressor gene HIC1 deregulates Bcl-xL mediated block in apoptosis.
24489730 2014 Small activating RNA restores the activity of the tumor suppressor HIC-1 on breast cancer.
24295734 2014 HIC1 silencing in triple-negative breast cancer drives progression through misregulation of LCN2.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24076391 2013 The Reelin receptors ApoER2 and VLDLR are direct target genes of HIC1 (Hypermethylated In Cancer 1).
24067369 2013 HIC1 interacts with and modulates the activity of STAT3.
23769968 2013 Inactivation of tumor suppressor gene HIC1 in gastric cancer is reversed via small activating RNAs.
More...