Property Summary

NCBI Gene PubMed Count 60
PubMed Score 106.97
PubTator Score 91.27

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
adrenocortical carcinoma -1.051 3.1e-05
Astrocytoma, Pilocytic 1.400 7.8e-04
atypical teratoid / rhabdoid tumor 1.500 2.7e-05
cystic fibrosis -1.295 6.5e-05
glioblastoma 1.300 1.5e-04
invasive ductal carcinoma -1.800 4.4e-04
medulloblastoma, large-cell 1.100 3.3e-03
primary pancreatic ductal adenocarcinoma 1.378 1.5e-02
tuberculosis -1.200 8.3e-04

Gene RIF (54)

AA Sequence

MTFPEADILLKSGECAGQTMLDTMEAPGHSRQLLLQLNNQRTKGFLCDVIIVVQNALFRAHKNVLAASSA      1 - 70
YLKSLVVHDNLLNLDHDMVSPAVFRLVLDFIYTGRLADGAEAAAAAAVAPGAEPSLGAVLAAASYLQIPD     71 - 140
LVALCKKRLKRHGKYCHLRGGGGGGGGYAPYGRPGRGLRAATPVIQACYPSPVGPPPPPAAEPPSGPEAA    141 - 210
VNTHCAELYASGPGPAAALCASERRCSPLCGLDLSKKSPPGSAAPERPLAERELPPRPDSPPSAGPAAYK    211 - 280
EPPLALPSLPPLPFQKLEEAAPPSDPFRGGSGSPGPEPPGRPDGPSLLYRWMKHEPGLGSYGDELGRERG    281 - 350
SPSERCEERGGDAAVSPGGPPLGLAPPPRYPGSLDGPGAGGDGDDYKSSSEETGSSEDPSPPGGHLEGYP    351 - 420
CPHLAYGEPESFGDNLYVCIPCGKGFPSSEQLNAHVEAHVEEEEALYGRAEAAEVAAGAAGLGPPFGGGG    421 - 490
DKVAGAPGGLGELLRPYRCASCDKSYKDPATLRQHEKTHWLTRPYPCTICGKKFTQRGTMTRHMRSHLGL    491 - 560
KPFACDACGMRFTRQYRLTEHMRIHSGEKPYECQVCGGKFAQQRNLISHMKMHAVGGAAGAAGALAGLGG    561 - 630
LPGVPGPDGKGKLDFPEGVFAVARLTAEQLSLKQQDKAAAAELLAQTTHFLHDPKVALESLYPLAKFTAE    631 - 700
LGLSPDKAAEVLSQGAHLAAGPDGRTIDRFSPT                                         701 - 733
//

Text Mined References (66)

PMID Year Title