Property Summary

Ligand Count 319
NCBI Gene PubMed Count 529
PubMed Score 1375.65
PubTator Score 1244.80

Knowledge Summary

Patent (69,825)

TINX Plot

  Disease (10)

Disease Target Count
Administration of Corneal Anesthesia 6
Administration of Local Anesthetic Nerve Block 14
Administration of Regional Anesthesia 7
Amyotrophic lateral sclerosis 451
Anesthesia for cesarean section 8
Angina Pectoris 32
Atrial Fibrillation 124
Bipolar affective disorder, current episode manic 13
Bipolar disorder in remission 19
Cardioversion of Atrial Fibrillation 9
Cough 25
Dysuria 26
Epilepsy 792
Epilepsy characterized by intractable complex partial seizures 28
Glossopharyngeal neuralgia 5
Hemorrhoids 13
Infestation by Phthirus pubis 7
Infestation by Sarcoptes scabiei var hominis 7
Itching of skin 18
Lennox-Gastaut syndrome 34
Life-Threatening Ventricular Tachycardia 15
Local Anesthesia for Endotracheal Intubation 6
Local Anesthesia for Ophthalmologic Procedure 7
Local Anesthesia for Urethral Pain 6
Local anesthesia 40
Local anesthesia, by infiltration 14
Local anesthetic intrathecal block 7
Localization-related epilepsy 13
Major Nerve Block for Surgery 8
Malaria 160
Migraine Prevention 23
Minor Skin Wound Pain 12
Mixed Epilepsy 3
Mixed bipolar I disorder 9
Motor cortex epilepsy 10
Mouth Irritation 12
Neuralgia 20
Parkinsonism 18
Paroxysmal atrial fibrillation 14
Paroxysmal atrial flutter 2
Paroxysmal supraventricular tachycardia 12
Partial seizure 15
Pediculosis capitis 7
Postherpetic neuralgia 11
Premature ejaculation 16
Prevent Minor Bacterial Skin Infection 10
Prevention of Paroxysmal Supraventricular Tachycardia 4
Prevention of Seizures following Cranial Trauma or Surgery 7
Pruritus ani 14
Pseudobulbar affect 5
Regional Anesthesia for Labor Pain 9
Regional Anesthesia for Ophthalmologic Surgery 6
Regional Anesthesia for Postoperative Pain 9
Regional Anesthesia for Surgery 9
Seizures in Neurosurgery 7
Simple partial seizure 26
Skin irritation 12
Sore throat symptom 12
Spasticity 26
Status Epilepticus 98
Suppression of the Gag Reflex 12
Tinea Infections 10
Tinea corporis 25
Tinea pedis 29
Tonic-clonic epilepsy 47
Tonic-clonic seizure 11
Trigeminal Neuralgia 24
Urethritis 10
Urinary Tract Irritation 24
Ventricular arrhythmia 27
Disease Target Count P-value
psoriasis 6694 6.1e-38
Disease Target Count Z-score Confidence
Heart conduction disease 83 0.0 3.0
Disease Target Count Z-score Confidence
Dilated cardiomyopathy 56 0.0 5.0
Left ventricular noncompaction 26 0.0 5.0
Disease Target Count Z-score Confidence
Cardiomyopathy 116 0.0 4.0
Familial atrial fibrillation 23 0.0 4.0
Disease Target Count Z-score Confidence
Heart disease 306 7.144 3.6
Timothy syndrome 11 3.36 1.7

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis -1.200 6.1e-38

Protein-protein Interaction (1)

Gene RIF (492)

AA Sequence

MANFLLPRGTSSFRRFTRESLAAIEKRMAEKQARGSTTLQESREGLPEEEAPRPQLDLQASKKLPDLYGN      1 - 70
PPQELIGEPLEDLDPFYSTQKTFIVLNKGKTIFRFSATNALYVLSPFHPIRRAAVKILVHSLFNMLIMCT     71 - 140
ILTNCVFMAQHDPPPWTKYVEYTFTAIYTFESLVKILARGFCLHAFTFLRDPWNWLDFSVIIMAYTTEFV    141 - 210
DLGNVSALRTFRVLRALKTISVISGLKTIVGALIQSVKKLADVMVLTVFCLSVFALIGLQLFMGNLRHKC    211 - 280
VRNFTALNGTNGSVEADGLVWESLDLYLSDPENYLLKNGTSDVLLCGNSSDAGTCPEGYRCLKAGENPDH    281 - 350
GYTSFDSFAWAFLALFRLMTQDCWERLYQQTLRSAGKIYMIFFMLVIFLGSFYLVNLILAVVAMAYEEQN    351 - 420
QATIAETEEKEKRFQEAMEMLKKEHEALTIRGVDTVSRSSLEMSPLAPVNSHERRSKRRKRMSSGTEECG    421 - 490
EDRLPKSDSEDGPRAMNHLSLTRGLSRTSMKPRSSRGSIFTFRRRDLGSEADFADDENSTAGESESHHTS    491 - 560
LLVPWPLRRTSAQGQPSPGTSAPGHALHGKKNSTVDCNGVVSLLGAGDPEATSPGSHLLRPVMLEHPPDT    561 - 630
TTPSEEPGGPQMLTSQAPCVDGFEEPGARQRALSAVSVLTSALEELEESRHKCPPCWNRLAQRYLIWECC    631 - 700
PLWMSIKQGVKLVVMDPFTDLTITMCIVLNTLFMALEHYNMTSEFEEMLQVGNLVFTGIFTAEMTFKIIA    701 - 770
LDPYYYFQQGWNIFDSIIVILSLMELGLSRMSNLSVLRSFRLLRVFKLAKSWPTLNTLIKIIGNSVGALG    771 - 840
NLTLVLAIIVFIFAVVGMQLFGKNYSELRDSDSGLLPRWHMMDFFHAFLIIFRILCGEWIETMWDCMEVS    841 - 910
GQSLCLLVFLLVMVIGNLVVLNLFLALLLSSFSADNLTAPDEDREMNNLQLALARIQRGLRFVKRTTWDF    911 - 980
CCGLLRQRPQKPAALAAQGQLPSCIATPYSPPPPETEKVPPTRKETRFEEGEQPGQGTPGDPEPVCVPIA    981 - 1050
VAESDTDDQEEDEENSLGTEEESSKQQESQPVSGGPEAPPDSRTWSQVSATASSEAEASASQADWRQQWK   1051 - 1120
AEPQAPGCGETPEDSCSEGSTADMTNTAELLEQIPDLGQDVKDPEDCFTEGCVRRCPCCAVDTTQAPGKV   1121 - 1190
WWRLRKTCYHIVEHSWFETFIIFMILLSSGALAFEDIYLEERKTIKVLLEYADKMFTYVFVLEMLLKWVA   1191 - 1260
YGFKKYFTNAWCWLDFLIVDVSLVSLVANTLGFAEMGPIKSLRTLRALRPLRALSRFEGMRVVVNALVGA   1261 - 1330
IPSIMNVLLVCLIFWLIFSIMGVNLFAGKFGRCINQTEGDLPLNYTIVNNKSQCESLNLTGELYWTKVKV   1331 - 1400
NFDNVGAGYLALLQVATFKGWMDIMYAAVDSRGYEEQPQWEYNLYMYIYFVIFIIFGSFFTLNLFIGVII   1401 - 1470
DNFNQQKKKLGGQDIFMTEEQKKYYNAMKKLGSKKPQKPIPRPLNKYQGFIFDIVTKQAFDVTIMFLICL   1471 - 1540
NMVTMMVETDDQSPEKINILAKINLLFVAIFTGECIVKLAALRHYYFTNSWNIFDFVVVILSIVGTVLSD   1541 - 1610
IIQKYFFSPTLFRVIRLARIGRILRLIRGAKGIRTLLFALMMSLPALFNIGLLLFLVMFIYSIFGMANFA   1611 - 1680
YVKWEAGIDDMFNFQTFANSMLCLFQITTSAGWDGLLSPILNTGPPYCDPTLPNSNGSRGDCGSPAVGIL   1681 - 1750
FFTTYIIISFLIVVNMYIAIILENFSVATEESTEPLSEDDFDMFYEIWEKFDPEATQFIEYSVLSDFADA   1751 - 1820
LSEPLRIAKPNQISLINMDLPMVSGDRIHCMDILFAFTKRVLGESGEMDALKIQMEEKFMAANPSKISYE   1821 - 1890
PITTTLRRKHEEVSAMVIQRAFRRHLLQRSLKHASFLFRQQAGSGLSEEDAPEREGLIAYVMSENFSRPL   1891 - 1960
GPPSSSSISSTSFPPSYDSVTRATSDNLQVRGSDYSHSEDLADFPPSPDRDRESIV                 1961 - 2016
//

Text Mined References (544)

PMID Year Title