Property Summary

NCBI Gene PubMed Count 67
Grant Count 11
Funding $922,237.48
PubMed Score 334.09
PubTator Score 169.70

Knowledge Summary

Patent

No data available

Expression

Gene RIF (54)

PMID Text
26832773 HABP2 G534E appears to be a susceptibility gene in a subgroup of Familial Non-Medullary Thyroid Cancer (FNMTC), providing important diagnostic implications for this hereditary thyroid cancer.
26745718 No evidence supporting a role for the HABP2 G534E variant (SNP rs7080536) in papillary thyroid carcinoma.
26732560 HABP2, which encodes an extracellular serine protease involved in coagulation, fibrinolysis, and inflammatory pathways, may be a genetic susceptibility locus for early-onset stroke. [Meta-Analysis]
26222560 results suggest that the HABP2 G534E variant is a susceptibility gene for familial nonmedullary thyroid cancer
25847894 CD44 expression in squamous cell carcinoma of the penis cannot predict the need of performing inguinal lymphadenectomy.
25370187 Patients with Gram-negative sepsis caused by B. pseudomallei have abundant FSAP activation, which significantly correlates with stage of disease.
24497464 FSAP functions in initiation and progression of hepatic fibrosis
24075769 FSAP activates the NF-kappaB pathway and the associated downstream pro-inflammatory factors in monocytic cells
23575879 The possible effects of omega-3 FA on clinical AF potential could be linked with modulation of circulating FSAP levels.
23341458 Data indicate that FSAP mediates proteolytic cleavage and activation of bone morphogenetic protein-2 (BMP-2).
More...

AA Sequence

MFARMSDLHVLLLMALVGKTACGFSLMSLLESLDPDWTPDQYDYSYEDYNQEENTSSTLTHAENPDWYYT      1 - 70
EDQADPCQPNPCEHGGDCLVHGSTFTCSCLAPFSGNKCQKVQNTCKDNPCGRGQCLITQSPPYYRCVCKH     71 - 140
PYTGPSCSQVVPVCRPNPCQNGATCSRHKRRSKFTCACPDQFKGKFCEIGSDDCYVGDGYSYRGKMNRTV    141 - 210
NQHACLYWNSHLLLQENYNMFMEDAETHGIGEHNFCRNPDADEKPWCFIKVTNDKVKWEYCDVSACSAQD    211 - 280
VAYPEESPTEPSTKLPGFDSCGKTEIAERKIKRIYGGFKSTAGKHPWQASLQSSLPLTISMPQGHFCGGA    281 - 350
LIHPCWVLTAAHCTDIKTRHLKVVLGDQDLKKEEFHEQSFRVEKIFKYSHYNERDEIPHNDIALLKLKPV    351 - 420
DGHCALESKYVKTVCLPDGSFPSGSECHISGWGVTETGKGSRQLLDAKVKLIANTLCNSRQLYDHMIDDS    421 - 490
MICAGNLQKPGQDTCQGDSGGPLTCEKDGTYYVYGIVSWGLECGKRPGVYTQVTKFLNWIKATIKSESGF    491 - 560
//

Text Mined References (69)

PMID Year Title
26832773 2016 HABP2 G534E Mutation in Familial Nonmedullary Thyroid Cancer.
26745718 2016 HABP2 G534E Variant in Papillary Thyroid Carcinoma.
26732560 2016 Genome-Wide Association Analysis of Young-Onset Stroke Identifies a Locus on Chromosome 10q25 Near HABP2.
26691890 2015 The HABP2 G534E variant is an unlikely cause of familial non-medullary thyroid cancer.
26258071 2015 HABP2 is a Novel Regulator of Hyaluronan-Mediated Human Lung Cancer Progression.
26222560 2015 Germline HABP2 Mutation Causing Familial Nonmedullary Thyroid Cancer.
25847894 2015 Is it possible to predict the need of inguinal lymphadenectomy in patients with squamous cell carcinoma of the penis? A clinical and a pathological study.
25370187 2015 Diabetes-independent increase of factor VII-activating protease activation in patients with Gram-negative sepsis (melioidosis).
24497464 2014 Factor VII activating protease (FSAP): a novel protective factor in liver fibrosis.
24075769 2013 Regulation of monocyte/macrophage function by factor VII activating protease (FSAP).
More...