Property Summary

NCBI Gene PubMed Count 27
PubMed Score 45.38
PubTator Score 35.58

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
Breast cancer -2.400 1.5e-21
diabetes mellitus 1.400 1.2e-03
esophageal adenocarcinoma -3.300 1.9e-02
intraductal papillary-mucinous neoplasm ... 3.000 1.1e-02
malignant mesothelioma -2.300 3.3e-06
non-small cell lung cancer 2.483 1.7e-09
psoriasis 1.700 3.9e-06
uncontrolled asthma 1.200 4.1e-02

Gene RIF (16)

AA Sequence

MKICSLTLLSFLLLAAQVLLVEGKKKVKNGLHSKVVSEQKDTLGNTQIKQKSRPGNKGKFVTKDQANCRW      1 - 70
AATEQEEGISLKVECTQLDHEFSCVFAGNPTSCLKLKDERVYWKQVARNLRSQKDICRYSKTAVKTRVCR     71 - 140
KDFPESSLKLVSSTLFGNTKPRKEKTEMSPREHIKGKETTPSSLAVTQTMATKAPECVEDPDMANQRKTA    141 - 210
LEFCGETWSSLCTFFLSIVQDTSC                                                  211 - 234
//

Text Mined References (28)

PMID Year Title