Property Summary

NCBI Gene PubMed Count 25
Grant Count 40
R01 Count 26
Funding $2,414,508.52
PubMed Score 42.56
PubTator Score 35.58

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
malignant mesothelioma -2.300 0.000
esophageal adenocarcinoma -3.300 0.019
uncontrolled asthma 1.200 0.041
psoriasis 2.300 0.000
non-small cell lung cancer 2.483 0.000
intraductal papillary-mucinous neoplasm ... 3.000 0.011
diabetes mellitus 1.400 0.001
Breast cancer -2.400 0.000

Gene RIF (14)

PMID Text
25704764 Up-regulated Sox12 induced by FoxQ1 promotes hepatocellular carcinoma invasion and metastasis by transactivating Twist1 and FGFBP1 expression.
25429350 HIV-1 Tat protein, but not HIV-1 Nef and gp120 proteins, competes with FGF-2 for binding to fibroblast growth factor binding protein 1 (FGF-BP1)
23592278 overexpression of FGFBP1 or loss of WISP-2 expression is closely related to the metastasis, invasion and poor prognosis of gallbladder cancer.
21436287 FGFBP1 associates with hypertension and that systematic analysis of signaling pathways can identify previously undescribed genetic associations.
20677014 Observational study of gene-disease association. (HuGE Navigator)
20634891 Observational study of gene-disease association. (HuGE Navigator)
20450993 Sequence variation in FGFBP1 may contribute to variation in bone mineral density, possibly influencing osteoporosis risk.
20450993 Observational study of gene-disease association. (HuGE Navigator)
19668233 KLF5 may promote breast cancer cell proliferation at least partially through directly activating the FGF-BP mRNA transcription.
19411256 KLF5 promotes breast cell survival partially through fibroblast growth factor-binding protein 1-pERK-mediated dual specificity MKP-1 protein phosphorylation and stabilization.
More...

AA Sequence

MKICSLTLLSFLLLAAQVLLVEGKKKVKNGLHSKVVSEQKDTLGNTQIKQKSRPGNKGKFVTKDQANCRW      1 - 70
AATEQEEGISLKVECTQLDHEFSCVFAGNPTSCLKLKDERVYWKQVARNLRSQKDICRYSKTAVKTRVCR     71 - 140
KDFPESSLKLVSSTLFGNTKPRKEKTEMSPREHIKGKETTPSSLAVTQTMATKAPECVEDPDMANQRKTA    141 - 210
LEFCGETWSSLCTFFLSIVQDTSC                                                  211 - 234
//

Text Mined References (26)

PMID Year Title
25704764 2015 Sox12, a direct target of FoxQ1, promotes hepatocellular carcinoma metastasis through up-regulating Twist1 and FGFBP1.
23592278 2014 A comparative study of clinicopathological significance, FGFBP1, and WISP-2 expression between squamous cell/adenosquamous carcinomas and adenocarcinoma of the gallbladder.
22020285 2011 Image-based genome-wide siRNA screen identifies selective autophagy factors.
21436287 2011 Pathway analysis shows association between FGFBP1 and hypertension.
20677014 2010 An approach based on a genome-wide association study reveals candidate loci for narcolepsy.
20634891 2010 Maternal genes and facial clefts in offspring: a comprehensive search for genetic associations in two population-based cleft studies from Scandinavia.
20450993 2010 A common variant in fibroblast growth factor binding protein 1 (FGFBP1) is associated with bone mineral density and influences gene expression in vitro.
19668233 2009 Krüppel-like factor 5 promotes breast cell proliferation partially through upregulating the transcription of fibroblast growth factor binding protein 1.
19411256 2009 KLF5 promotes breast cell survival partially through fibroblast growth factor-binding protein 1-pERK-mediated dual specificity MKP-1 protein phosphorylation and stabilization.
17178288 2006 The angiogenic switch molecule, secreted FGF-binding protein, an indicator of early stages of pancreatic and colorectal adenocarcinoma.
More...