Property Summary

NCBI Gene PubMed Count 111
PubMed Score 230.52
PubTator Score 191.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (31)

Disease log2 FC p
adrenocortical adenoma -1.284 2.3e-02
adrenocortical carcinoma -1.727 7.7e-04
astrocytoma 1.200 2.2e-11
Astrocytoma, Pilocytic 1.100 2.5e-02
Barrett's esophagus 1.500 4.2e-02
Breast cancer -1.900 4.2e-02
breast carcinoma -1.100 7.6e-16
chronic lymphosyte leukemia -1.100 2.0e-07
colon cancer -1.400 4.7e-02
cystic fibrosis -1.300 1.8e-03
ependymoma 1.300 1.3e-02
esophageal adenocarcinoma 1.400 2.0e-02
gastric carcinoma 1.400 3.2e-02
glioblastoma 2.800 1.3e-03
Hydrolethalus syndrome 1.398 4.9e-02
interstitial cystitis 2.100 9.9e-04
interstitial lung disease -1.700 2.6e-02
intraductal papillary-mucinous adenoma (... 1.700 2.9e-03
lung adenocarcinoma -1.200 2.3e-09
lung cancer -3.400 7.6e-06
lung carcinoma -1.200 5.2e-15
medulloblastoma -1.300 2.4e-02
medulloblastoma, large-cell -2.900 4.8e-05
non-small cell lung cancer -1.994 3.9e-22
oligodendroglioma 1.200 2.6e-08
osteosarcoma 1.475 2.0e-03
ovarian cancer 1.500 7.9e-13
periodontitis 1.200 2.0e-25
Pick disease 1.200 1.4e-03
primary pancreatic ductal adenocarcinoma 1.142 4.9e-03
psoriasis -1.400 3.5e-05

Protein-protein Interaction (2)

Gene RIF (76)

AA Sequence

MKYKNLMARALYDNVPECAEELAFRKGDILTVIEQNTGGLEGWWLCSLHGRQGIVPGNRVKLLIGPMQET      1 - 70
ASSHEQPASGLMQQTFGQQKLYQVPNPQAAPRDTIYQVPPSYQNQGIYQVPTGHGTQEQEVYQVPPSVQR     71 - 140
SIGGTSGPHVGKKVITPVRTGHGYVYEYPSRYQKDVYDIPPSHTTQGVYDIPPSSAKGPVFSVPVGEIKP    141 - 210
QGVYDIPPTKGVYAIPPSACRDEAGLREKDYDFPPPMRQAGRPDLRPEGVYDIPPTCTKPAGKDLHVKYN    211 - 280
CDIPGAAEPVARRHQSLSPNHPPPQLGQSVGSQNDAYDVPRGVQFLEPPAETSEKANPQERDGVYDVPLH    281 - 350
NPPDAKGSRDLVDGINRLSFSSTGSTRSNMSTSSTSSKESSLSASPAQDKRLFLDPDTAIERLQRLQQAL    351 - 420
EMGVSSLMALVTTDWRCYGYMERHINEIRTAVDKVELFLKEYLHFVKGAVANAACLPELILHNKMKRELQ    421 - 490
RVEDSHQILSQTSHDLNECSWSLNILAINKPQNKCDDLDRFVMVAKTVPDDAKQLTTTINTNAEALFRPG    491 - 560
PGSLHLKNGPESIMNSTEYPHGGSQGQLLHPGDHKAQAHNKALPPGLSKEQAPDCSSSDGSERSWMDDYD    561 - 630
YVHLQGKEEFERQQKELLEKENIMKQNKMQLEHHQLSQFQLLEQEITKPVENDISKWKPSQSLPTTNSGV    631 - 700
SAQDRQLLCFYYDQCETHFISLLNAIDALFSCVSSAQPPRIFVAHSKFVILSAHKLVFIGDTLTRQVTAQ    701 - 770
DIRNKVMNSSNQLCEQLKTIVMATKMAALHYPSTTALQEMVHQVTDLSRNAQLFKRSLLEMATF          771 - 834
//

Text Mined References (114)

PMID Year Title