Property Summary

NCBI Gene PubMed Count 107
Grant Count 112
R01 Count 83
Funding $9,954,072.73
PubMed Score 217.14
PubTator Score 191.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (31)

Disease log2 FC p
interstitial lung disease -1.700 0.026
posterior fossa group B ependymoma 1.400 0.000
Barrett's esophagus 1.500 0.042
esophageal adenocarcinoma 1.400 0.020
psoriasis -2.300 0.000
astrocytoma 1.200 0.000
glioblastoma 2.800 0.001
oligodendroglioma 1.200 0.000
osteosarcoma -2.736 0.000
chronic lymphosyte leukemia -1.100 0.000
periodontitis 1.200 0.000
medulloblastoma -1.300 0.024
medulloblastoma, large-cell -2.900 0.000
adrenocortical adenoma -1.284 0.023
adrenocortical carcinoma -1.727 0.001
primary pancreatic ductal adenocarcinoma 1.142 0.005
non-small cell lung cancer -1.994 0.000
intraductal papillary-mucinous adenoma (... 1.700 0.003
Hydrolethalus syndrome 1.398 0.049
lung cancer -3.400 0.000
colon cancer -1.400 0.047
Breast cancer -2.200 0.000
interstitial cystitis 2.100 0.001
cystic fibrosis -1.300 0.002
lung adenocarcinoma -2.300 0.000
pilocytic astrocytoma 1.100 0.025
lung carcinoma -1.200 0.000
breast carcinoma -1.100 0.000
Pick disease 1.200 0.001
gastric carcinoma 1.400 0.032
ovarian cancer 2.200 0.000

Synonym

Accession Q14511 A8K9G7 A8MSJ9 G5E9Y9 Q5T9R4 Q5XKI0 hEF1
Symbols CAS2
CASL
HEF1
CAS-L
CASS2

Gene

PDB

2L81  

Gene RIF (72)

PMID Text
26351211 siRNA suppression of NEDD9 inhibits proliferation and enhances apoptosis in renal cell carcinoma.
26324022 NEDD9 has an essential role in development as well as in neoplastic cell proliferation, apoptosis, adhesion, migration and invasion. (Review)
26211595 Serum NEDD9 was elevated in gastric cancer patients and had an unfavorable prognostic effect.
26011298 The presence of the dna fragment in the NSCLC-N6-L16 cell ChIP assays demonstrated a physical link between NEDD9 and p53.
25967390 discuss emerging evidence supporting involvement of NEDD9 in additional pathological conditions, including stroke and polycystic kidney disease
25817040 BCAR3 is an essential interactor and mediator of HEF1-induced migration.
25646678 miR145 is inversely correlated with NEDD9 expression in pancreatic cancer tissues and restoration of miR145 in Panc1 cells reduced NEDD9 mRNA and protein expression accompanied by inhibition of cell proliferation, invasion and migration.
25577245 our findings suggest that NEDD9 acts as an oncogene and promotes GC metastasis via EMT.
25445787 NEDD9 expression in breast cancer cells enhances the expression of chondroitin sulfate glycosaminoglycans, particularly the CS-E subunit that enhances growth.
25319010 Study uncovers a new role of NEDD9 as a regulator of integrin trafficking through CAV1-dependent endocytosis, and provide new insight into the regulation of migration of breast cancer cells.
More...

AA Sequence

MKYKNLMARALYDNVPECAEELAFRKGDILTVIEQNTGGLEGWWLCSLHGRQGIVPGNRVKLLIGPMQET      1 - 70
ASSHEQPASGLMQQTFGQQKLYQVPNPQAAPRDTIYQVPPSYQNQGIYQVPTGHGTQEQEVYQVPPSVQR     71 - 140
SIGGTSGPHVGKKVITPVRTGHGYVYEYPSRYQKDVYDIPPSHTTQGVYDIPPSSAKGPVFSVPVGEIKP    141 - 210
QGVYDIPPTKGVYAIPPSACRDEAGLREKDYDFPPPMRQAGRPDLRPEGVYDIPPTCTKPAGKDLHVKYN    211 - 280
CDIPGAAEPVARRHQSLSPNHPPPQLGQSVGSQNDAYDVPRGVQFLEPPAETSEKANPQERDGVYDVPLH    281 - 350
NPPDAKGSRDLVDGINRLSFSSTGSTRSNMSTSSTSSKESSLSASPAQDKRLFLDPDTAIERLQRLQQAL    351 - 420
EMGVSSLMALVTTDWRCYGYMERHINEIRTAVDKVELFLKEYLHFVKGAVANAACLPELILHNKMKRELQ    421 - 490
RVEDSHQILSQTSHDLNECSWSLNILAINKPQNKCDDLDRFVMVAKTVPDDAKQLTTTINTNAEALFRPG    491 - 560
PGSLHLKNGPESIMNSTEYPHGGSQGQLLHPGDHKAQAHNKALPPGLSKEQAPDCSSSDGSERSWMDDYD    561 - 630
YVHLQGKEEFERQQKELLEKENIMKQNKMQLEHHQLSQFQLLEQEITKPVENDISKWKPSQSLPTTNSGV    631 - 700
SAQDRQLLCFYYDQCETHFISLLNAIDALFSCVSSAQPPRIFVAHSKFVILSAHKLVFIGDTLTRQVTAQ    701 - 770
DIRNKVMNSSNQLCEQLKTIVMATKMAALHYPSTTALQEMVHQVTDLSRNAQLFKRSLLEMATF          771 - 834
//

Text Mined References (110)

PMID Year Title
26351211 2014 siRNA Suppression of NEDD9 Inhibits Proliferation and Enhances Apoptosis in Renal Cell Carcinoma.
26324022 2015 Roles of neural precursor cell expressed, developmentally downregulated 9 in tumor-associated cellular processes (Review).
26211595 2015 Serum neural precursor cell-expressed, developmentally down regulated 9 (NEDD9) level may have a prognostic role in patients with gastric cancer.
26011298 2015 TP53 transcription factor for the NEDD9/HEF1/Cas-L gene: potential targets in Non-Small Cell Lung Cancer treatment.
25967390 2015 Preclinical and clinical studies of the NEDD9 scaffold protein in cancer and other diseases.
25817040 2015 Human enhancer of filamentation 1-induced colorectal cancer cell migration: Role of serine phosphorylation and interaction with the breast cancer anti-estrogen resistance 3 protein.
25646678 2015 MicroRNA-145 suppresses cell proliferation, invasion and migration in pancreatic cancer cells by targeting NEDD9.
25577245 2015 Involvement of NEDD9 in the invasion and migration of gastric cancer.
25445787 2015 Role for chondroitin sulfate glycosaminoglycan in NEDD9-mediated breast cancer cell growth.
25416956 2014 A proteome-scale map of the human interactome network.
More...