Property Summary

NCBI Gene PubMed Count 114
PubMed Score 32.92
PubTator Score 296.25

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count P-value
psoriasis 6685 1.485429254426E-30
Breast cancer 3099 8.53980053132254E-13
non-small cell lung carcinoma 413 1.12237014198667E-11
lung adenocarcinoma 2714 1.69169043035073E-5
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.010306573064296
Disease Target Count Z-score Confidence
Alzheimer's disease 644 0.0 1.0
Disease Target Count Z-score Confidence
ovarian cancer 8492 4.191 2.1
Endometriosis 535 3.293 1.6

Expression

  Differential Expression (6)

Disease log2 FC p
intraductal papillary-mucinous neoplasm ... 1.100 0.010
lung adenocarcinoma 2.100 0.000
non-small cell lung carcinoma 1.100 0.000
Breast cancer -1.300 0.000
ovarian cancer 1.300 0.000
psoriasis -1.500 0.000

Synonym

Accession Q14508 A2A2A5 A2A2A6 A6PVD5 Q6IB27 Q8WXV9 Q8WXW0 Q8WXW1 Q8WXW2 Q96KJ1
Symbols HE4
WAP5
EDDM4
dJ461P17.6

Gene

  Ortholog (9)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum EggNOG Inparanoid
Platypus OMA EggNOG

Gene RIF (98)

PMID Text
26928556 Increased WFDC2 expression plays an important role in altering the estrogen pathway in ovarian cancer.
26730601 Data show that serum neuron-specific enolase, cytokeratin 19 fragment 21-1, pro-gastrin-releasing peptide, squamous cell carcinoma antigen, tissue inhibitor of metalloproteinase-1, and human epididymis protein 4 are not associated with brain metastases.
26575020 Data suggest that overexpressed human epididymis protein 4 (HE4) played an important role in ovarian cancer progression and metastasis and that HE4 has the potential to serve as therapeutic target for ovarian cancer.
26539494 Endometrial cancer patients with high HE4 expression have a poor prognosis.
26497244 Results show that recombinant HE4 proteins are able to promote the proliferation of pancreatic and endometrial cancer cells suggesting that HE4 secreted from cancer cells may carry out paracrine and endocrine functions in cancer patients.
26362938 Expression levels of ANXA2 and HE4 were closely related to the malignant biological behavior of endometrial carcinoma
26285075 optimal cut-off values (HE4: 70pmol/l for all; CA125: 60U/ml for pre- and 35U/ml for postmenopausal women) could notably improve diagnostic performance in EOC detection in patients in southern China
26117969 High expression of WFDC2 was demonstrated for both, EOC and fallopian tube, as opposed to its low expression observed in normal ovaries suggesting that EOC is derived from fallopian tube rather than ovary
26030627 High serum HE4 level at diagnosis is an independent determinant of poor prognosis in NSCLC.
25920696 Body mass index does not influence HE4 levels in serum.
More...

AA Sequence

MPACRLGPLAAALLLSLLLFGFTLVSGTGAEKTGVCPELQADQNCTQECVSDSECADNLKCCSAGCATFC      1 - 70
SLPNDKEGSCPQVNINFPQLGLCRDQCQVDSQCPGQMKCCRNGCGKVSCVTPNF                     71 - 124
//

Text Mined References (114)

PMID Year Title
26928556 2016 WAP four-disulfide core domain protein 2 gene(WFDC2) is a target of estrogen in ovarian cancer cells.
26730601 2016 Serum Biomarkers Associated with Clinical Outcomes Fail to Predict Brain Metastases in Patients with Stage IV Non-Small Cell Lung Cancers.
26575020 2016 Overexpression of HE4 (human epididymis protein 4) enhances proliferation, invasion and metastasis of ovarian cancer.
26539494 2015 Expression of HE4 in Endometrial Cancer and Its Clinical Significance.
26497244 2016 Recombinant HE4 protein promotes proliferation of pancreatic and endometrial cancer cell lines.
26362938 2015 Expression and clinical significance of annexin A2 and human epididymis protein 4 in endometrial carcinoma.
26285075 2016 Modification of cut-off values for HE4, CA125 and the ROMA algorithm for early-stage epithelial ovarian cancer detection: Results from 1021 cases in South China.
26117969 2015 Ovarian cancer and normal fallopian tube high WFDC2 expression does not correlate with HE4 serum level.
26030627 2015 Serum HE4: An Independent Prognostic Factor in Non-Small Cell Lung Cancer.
25920696 2015 Body mass index does not influence human epididymis protein 4 concentrations in serum.
More...