Property Summary

NCBI Gene PubMed Count 139
PubMed Score 35.98
PubTator Score 296.25

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Liver Cirrhosis, Experimental 769 0.0 0.0
Disease Target Count Z-score Confidence
Alzheimer's disease 658 0.0 1.7
Disease Target Count Z-score Confidence
Endometriosis 540 3.223 1.6

Expression

  Differential Expression (6)

Disease log2 FC p
ovarian cancer 1.300 4.8e-10
Breast cancer -1.300 8.5e-13
intraductal papillary-mucinous neoplasm ... 1.100 1.0e-02
lung adenocarcinoma 1.500 1.8e-11
non-small cell lung carcinoma 1.100 1.1e-11
psoriasis -1.500 1.5e-30

Gene RIF (123)

AA Sequence

MPACRLGPLAAALLLSLLLFGFTLVSGTGAEKTGVCPELQADQNCTQECVSDSECADNLKCCSAGCATFC      1 - 70
SLPNDKEGSCPQVNINFPQLGLCRDQCQVDSQCPGQMKCCRNGCGKVSCVTPNF                     71 - 124
//

Text Mined References (139)

PMID Year Title