Property Summary

NCBI Gene PubMed Count 8
Grant Count 4
R01 Count 4
Funding $317,634.25
PubMed Score 8.25
PubTator Score 7.95

Knowledge Summary

Patent

No data available

AA Sequence

MTSSLKIWGILLALLCILCRLCVYSNNIYWREFIKLHYLSPSREFKEYKCDVLMREKEALKGKSFHMFIY      1 - 70
SLWFKIQRACINEKGSDRYRNAYVWAPGALKVLECHWEKYNNRYTESRSFSYIEFHCGVDGYVDNIEDLR     71 - 140
IIEPISN                                                                   141 - 147
//

Text Mined References (8)

PMID Year Title
24337645 2014 Comparative genomic analysis of eutherian ribonuclease A genes.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11715855 2001 Human epididymal proteins and sperm function during fertilization: un update.
9739419 Function of human epididymal proteins in sperm maturation.
9685187 1998 Molecular characterization of epididymal proteins.
7514008 1994 Major human epididymis-specific gene product, HE3, is the first representative of a novel gene family.