Property Summary

NCBI Gene PubMed Count 33
Grant Count 24
R01 Count 16
Funding $1,876,214.77
PubMed Score 73.97
PubTator Score 62.83

Knowledge Summary

Patent (1,862)

Expression

 GWAS Trait (1)

Gene RIF (13)

PMID Text
26324774 The augmentation of Ca(2+) influx and cytokine release suggests a physiological role for Kir2.2 in TLR4-stimulated monocytes.
23269273 Unconventional role of the inwardly rectifying potassium channel Kir2.2 as a constitutive activator of RelA in cancer.
21281576 Kir2.1 and Kir2.2 have two distinct lipid requirements for activity.
20921230 KIr2.1 and Kir2.2 are directly activated by membrane phosphatidylinositol 4,5-bisphosphate.
20841375 Kir2.2 knockdown induces senescence of cancer cells by a mechanism involving reactive oxygen species accumulation.
20676672 Kir2.1 and Kir2.2 subunits exert neither a dominant nor an anomalous effect on any of the properties of heteromeric channels.
19016473 Data show that the recovery of K(ir)2.2 from inhibition by FCCP requires intracellular components, but direct depletion of ATP does not reproduce the differential inhibitory effect of FCCP.
16373386 In conclusion, the data are consistent with the universal mechanism of rectification in Kir2 channels, but also point to significant, and physiologically important, quantitative differences between Kir2 isoforms.
16258766 Results describe the regulation of inwardly rectifying potassium current and its main molecular correlates, Kir2.1, Kir2.2 and Kir2.3 channels, by endothelin-1 in human atrial cardiomyocytes.
15958527 Kir2.2 and Kir2.1 are primary determinants of endogenous K(+) conductance in HAECs under resting conditions and that Kir2.2 provides the dominant conductance in these cells.
More...

AA Sequence

MTAASRANPYSIVSSEEDGLHLVTMSGANGFGNGKVHTRRRCRNRFVKKNGQCNIEFANMDEKSQRYLAD      1 - 70
MFTTCVDIRWRYMLLIFSLAFLASWLLFGIIFWVIAVAHGDLEPAEGRGRTPCVMQVHGFMAAFLFSIET     71 - 140
QTTIGYGLRCVTEECPVAVFMVVAQSIVGCIIDSFMIGAIMAKMARPKKRAQTLLFSHNAVVALRDGKLC    141 - 210
LMWRVGNLRKSHIVEAHVRAQLIKPRVTEEGEYIPLDQIDIDVGFDKGLDRIFLVSPITILHEIDEASPL    211 - 280
FGISRQDLETDDFEIVVILEGMVEATAMTTQARSSYLANEILWGHRFEPVLFEEKNQYKIDYSHFHKTYE    281 - 350
VPSTPRCSAKDLVENKFLLPSANSFCYENELAFLSRDEEDEADGDQDGRSRDGLSPQARHDFDRLQAGGG    351 - 420
VLEQRPYRRESEI                                                             421 - 433
//

Text Mined References (33)

PMID Year Title
26324774 2015 Rise and Fall of Kir2.2 Current by TLR4 Signaling in Human Monocytes: PKC-Dependent Trafficking and PI3K-Mediated PIP2 Decrease.
23889090 2013 Altered expression of genes for Kir ion channels in dilated cardiomyopathy.
23269273 2013 Unconventional role of the inwardly rectifying potassium channel Kir2.2 as a constitutive activator of RelA in cancer.
21874019 2011 Structural basis of PIP2 activation of the classical inward rectifier K+ channel Kir2.2.
21281576 2011 Dual-mode phospholipid regulation of human inward rectifying potassium channels.
20921230 2010 Direct and specific activation of human inward rectifier K+ channels by membrane phosphatidylinositol 4,5-bisphosphate.
20881960 2010 Hundreds of variants clustered in genomic loci and biological pathways affect human height.
20841375 2010 Knockdown of inwardly rectifying potassium channel Kir2.2 suppresses tumorigenesis by inducing reactive oxygen species-mediated cellular senescence.
20676672 2010 Functional consequences of Kir2.1/Kir2.2 subunit heteromerization.
19016473 2009 Kir 2.2 inward rectifier potassium channels are inhibited by an endogenous factor in Xenopus oocytes independently from the action of a mitochondrial uncoupler.
More...