Property Summary

NCBI Gene PubMed Count 34
PubMed Score 40.87
PubTator Score 20.87

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
breast carcinoma 1.600 3.5e-02
intraductal papillary-mucinous carcinoma... 1.200 2.7e-03
osteosarcoma -1.035 1.3e-02
ovarian cancer -1.500 4.8e-08
primary pancreatic ductal adenocarcinoma 1.114 3.4e-03
psoriasis -1.800 3.8e-05
subependymal giant cell astrocytoma 1.337 7.9e-03

Gene RIF (13)

AA Sequence

MLSLKKYLTEGLLQFTILLSLIGVRVDVDTYLTSQLPPLREIILGPSSAYTQTQFHNLRNTLDGYGIHPK      1 - 70
SIDLDNYFTARRLLSQVRALDRFQVPTTEVNAWLVHRDPEGSVSGSQPNSGLALESSSGLQDVTGPDNGV     71 - 140
RESETEQGFGEDLEDLGAVAPPVSGDLTKEDIDLIDILWRQDIDLGAGREVFDYSHRQKEQDVEKELRDG    141 - 210
GEQDTWAGEGAEALARNLLVDGETGESFPAQVPSGEDQTALSLEECLRLLEATCPFGENAEFPADISSIT    211 - 280
EAVPSESEPPALQNNLLSPLLTGTESPFDLEQQWQDLMSIMEMQAMEVNTSASEILYSAPPGDPLSTNYS    281 - 350
LAPNTPINQNVSLHQASLGGCSQDFLLFSPEVESLPVASSSTLLPLAPSNSTSLNSTFGSTNLTGLFFPP    351 - 420
QLNGTANDTAGPELPDPLGGLLDEAMLDEISLMDLAIEEGFNPVQASQLEEEFDSDSGLSLDSSHSPSSL    421 - 490
SSSEGSSSSSSSSSSSSSSASSSASSSFSEEGAVGYSSDSETLDLEEAEGAVGYQPEYSKFCRMSYQDPA    491 - 560
QLSCLPYLEHVGHNHTYNMAPSALDSADLPPPSALKKGSKEKQADFLDKQMSRDEHRARAMKIPFTNDKI    561 - 630
INLPVEEFNELLSKYQLSEAQLSLIRDIRRRGKNKMAAQNCRKRKLDTILNLERDVEDLQRDKARLLREK    631 - 700
VEFLRSLRQMKQKVQSLYQEVFGRLRDENGRPYSPSQYALQYAGDGSVLLIPRTMADQQARRQERKPKDR    701 - 770
RK                                                                        771 - 772
//

Text Mined References (35)

PMID Year Title