Property Summary

NCBI Gene PubMed Count 33
Grant Count 7
R01 Count 3
Funding $615,538.5
PubMed Score 36.76
PubTator Score 20.87

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Gene RIF (12)

PMID Text
26231763 Nrf1 is negatively regulated by its O-GlcNAcylation status that depends on the glucose concentrations
24448410 Data uncover an unexpected role for p97 in activation of transcription factor Nrf1 by relocalizing it from the endoplasmic reticulum lumen to the cytosol.
23816881 The study identifies casein kinase 2 as an NRF1-binding protein and finds that the knockdown of casein kinase 2 enhances the NRF1-dependent expression of the proteasome subunit genes.
23623971 GSK3 regulates Nrf1 expression and cell survival function in response to stress activation.
22971132 findings suggest that nuclear-related factor erythroid 2 transcription factor (Nrf1) may play a role in maintaining genomic integrity, and that Nrf1 dysregulation may induce tumorigenesis
22932898 A proteasome inhibitor-stimulated Nrf1 protein-dependent compensatory increase in proteasome subunit gene expression reduces polycomb group protein level
22216197 data suggests that Nrf1 is controlled by several post-translational mechanisms, including ubiquitination, proteolytic processing and proteasomal-mediated degradation as well as by its phosphorylation status
20932482 Report that proteasome inhibition can be anticipated by TCF11-dependent activation of human proteasome gene expression, which in turn is controlled by a HRD1-p97-ERAD feedback circle.
20385086 Data show that nuclear factor erythroid-derived 2-related factor 1 (Nrf1), but not the related Nrf2, is necessary for induced proteasome gene transcription in mouse embryonic fibroblasts.
20237496 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MLSLKKYLTEGLLQFTILLSLIGVRVDVDTYLTSQLPPLREIILGPSSAYTQTQFHNLRNTLDGYGIHPK      1 - 70
SIDLDNYFTARRLLSQVRALDRFQVPTTEVNAWLVHRDPEGSVSGSQPNSGLALESSSGLQDVTGPDNGV     71 - 140
RESETEQGFGEDLEDLGAVAPPVSGDLTKEDIDLIDILWRQDIDLGAGREVFDYSHRQKEQDVEKELRDG    141 - 210
GEQDTWAGEGAEALARNLLVDGETGESFPAQVPSGEDQTALSLEECLRLLEATCPFGENAEFPADISSIT    211 - 280
EAVPSESEPPALQNNLLSPLLTGTESPFDLEQQWQDLMSIMEMQAMEVNTSASEILYSAPPGDPLSTNYS    281 - 350
LAPNTPINQNVSLHQASLGGCSQDFLLFSPEVESLPVASSSTLLPLAPSNSTSLNSTFGSTNLTGLFFPP    351 - 420
QLNGTANDTAGPELPDPLGGLLDEAMLDEISLMDLAIEEGFNPVQASQLEEEFDSDSGLSLDSSHSPSSL    421 - 490
SSSEGSSSSSSSSSSSSSSASSSASSSFSEEGAVGYSSDSETLDLEEAEGAVGYQPEYSKFCRMSYQDPA    491 - 560
QLSCLPYLEHVGHNHTYNMAPSALDSADLPPPSALKKGSKEKQADFLDKQMSRDEHRARAMKIPFTNDKI    561 - 630
INLPVEEFNELLSKYQLSEAQLSLIRDIRRRGKNKMAAQNCRKRKLDTILNLERDVEDLQRDKARLLREK    631 - 700
VEFLRSLRQMKQKVQSLYQEVFGRLRDENGRPYSPSQYALQYAGDGSVLLIPRTMADQQARRQERKPKDR    701 - 770
RK                                                                        771 - 772
//

Text Mined References (34)

PMID Year Title
26231763 2015 Transcription factor Nrf1 is negatively regulated by its O-GlcNAcylation status.
24448410 2014 p97-dependent retrotranslocation and proteolytic processing govern formation of active Nrf1 upon proteasome inhibition.
23816881 2013 The casein kinase 2-nrf1 axis controls the clearance of ubiquitinated proteins by regulating proteasome gene expression.
23623971 2013 Glycogen synthase kinase 3 regulates expression of nuclear factor-erythroid-2 related transcription factor-1 (Nrf1) and inhibits pro-survival function of Nrf1.
22971132 2012 Deficiency in the nuclear-related factor erythroid 2 transcription factor (Nrf1) leads to genetic instability.
22949513 2012 Genome-wide association analysis of genetic generalized epilepsies implicates susceptibility loci at 1q43, 2p16.1, 2q22.3 and 17q21.32.
22932898 2012 A proteasome inhibitor-stimulated Nrf1 protein-dependent compensatory increase in proteasome subunit gene expression reduces polycomb group protein level.
22216197 2011 The Nrf1 CNC-bZIP protein is regulated by the proteasome and activated by hypoxia.
20935630 2010 Association analyses of 249,796 individuals reveal 18 new loci associated with body mass index.
20932482 2010 Proteasomal degradation is transcriptionally controlled by TCF11 via an ERAD-dependent feedback loop.
More...