Property Summary

NCBI Gene PubMed Count 49
PubMed Score 135.86
PubTator Score 78.94

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
juvenile dermatomyositis 1187 1.0e-09
colon cancer 1478 8.2e-05
psoriasis 6694 1.3e-04
ovarian cancer 8520 4.9e-03
Waldenstrons macroglobulinemia 765 7.5e-03
lung cancer 4740 1.9e-02
Disease Target Count Z-score Confidence
Wolf-Hirschhorn syndrome 32 3.105 1.6

Expression

  Differential Expression (6)

Disease log2 FC p
colon cancer 1.700 8.2e-05
juvenile dermatomyositis 1.008 1.0e-09
lung cancer 1.600 1.9e-02
ovarian cancer 1.500 4.9e-03
psoriasis 1.300 1.3e-04
Waldenstrons macroglobulinemia 1.114 7.5e-03

Protein-protein Interaction (3)

Gene RIF (29)

AA Sequence

MACRPRSPPRHQSRCDGDASPPSPARWSLGRKRRADGRRWRPEDAEEAEHRGAERRPESFTTPEGPKPRS      1 - 70
RCSDWASAVEEDEMRTRVNKEMARYKRKLLINDFGRERKSSSGSSDSKESMSTVPADFETDESVLMRRQK     71 - 140
QINYGKNTIAYDRYIKEVPRHLRQPGIHPKTPNKFKKYSRRSWDQQIKLWKVALHFWDPPAEEGCDLQEI    141 - 210
HPVDLESAESSSEPQTSSQDDFDVYSGTPTKVRHMDSQVEDEFDLEACLTEPLRDFSAMS              211 - 270
//

Text Mined References (57)

PMID Year Title