Property Summary

NCBI Gene PubMed Count 112
Grant Count 216
R01 Count 149
Funding $17,922,552.64
PubMed Score 48.14
PubTator Score 330.33

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q14469 Q6FHB2
Symbols HHL
HRY
HES-1
bHLHb39

Gene

PDB

2MH3  

Gene RIF (93)

PMID Text
26452029 Results provide functional and mechanistic links between Hes1 and Bmi-1/PTEN/Akt/GSK3beta signaling in the development and progression of colon cancer.
26448192 Suggest that loss of Hes1 could be used as a sensitive and specific marker to differentiate sessile serrated adenomas/polyps from hyperplastic polyps.
26092281 overexpression of HES1 in primary AML cells inhibited growth of AML in a xenograft mice model. In conclusion, we demonstrated the tumor suppressor role of HES1 in AML.
25987042 Decreased HES1 expression is associated with higher lung metastasis in hepatocellular carcinoma
25920606 Interference with Notch1 increased the expression level of Hes-1.
25906782 HES1 DMROI methylation predicted differences in early infant behaviour, known to be associated with academic success. In vitro, methylation of HES1 inhibited ETS transcription factor binding, suggesting a functional role of this site.
25849484 High Hes1 expression is associated with chronic myeloid leukemia.
25817041 OR1A1 activation suppresses hepatic triglyceride metabolism by modulating HES-1, PPARG, and mtGPAT expression.
25784680 Hairy and Enhancer of Split 1 (HES1), a transcriptional repressor controlled by NOTCH1, is a critical mediator of NOTCH1-induced leukemogenesis strictly required for tumor cell survival.
25781910 we summarize the recent data supporting the idea that Hes1 may have an important function in the maintenance of cancer stem cells self-renewal, cancer metastasis, and epithelial-mesenchymal transition (EMT) process induction
More...

AA Sequence

MPADIMEKNSSSPVAATPASVNTTPDKPKTASEHRKSSKPIMEKRRRARINESLSQLKTLILDALKKDSS      1 - 70
RHSKLEKADILEMTVKHLRNLQRAQMTAALSTDPSVLGKYRAGFSECMNEVTRFLSTCEGVNTEVRTRLL     71 - 140
GHLANCMTQINAMTYPGQPHPALQAPPPPPPGPGGPQHAPFAPPPPLVPIPGGAAPPPGGAPCKLGSQAG    141 - 210
EAAKVFGGFQVVPAPDGQFAFLIPNGAFAHSGPVIPVYTSNSGTSVGPNAVSPSSGPSLTADSMWRPWRN    211 - 280
//

Text Mined References (115)

PMID Year Title
26452029 2015 Hes1 promotes cell proliferation and migration by activating Bmi-1 and PTEN/Akt/GSK3? pathway in human colon cancer.
26448192 2016 Loss of Hes1 Differentiates Sessile Serrated Adenoma/Polyp From Hyperplastic Polyp.
26092281 2015 HES1 activation suppresses proliferation of leukemia cells in acute myeloid leukemia.
25987042 2015 Prognostic significance of Hes-1, a downstream target of notch signaling in hepatocellular carcinoma.
25920606 2015 Interference of Notch1 inhibits the growth of glioma cancer cells by inducing cell autophagy and down-regulation of Notch1-Hes-1 signaling pathway.
25906782 2015 Association between perinatal methylation of the neuronal differentiation regulator HES1 and later childhood neurocognitive function and behaviour.
25849484 2015 Potential role of Notch signalling in CD34+ chronic myeloid leukaemia cells: cross-talk between Notch and BCR-ABL.
25817041 2015 Activation of OR1A1 suppresses PPAR-? expression by inducing HES-1 in cultured hepatocytes.
25784680 2015 Therapeutic targeting of HES1 transcriptional programs in T-ALL.
25781910 2015 Hes1: a key role in stemness, metastasis and multidrug resistance.
More...