Property Summary

NCBI Gene PubMed Count 130
PubMed Score 55.54
PubTator Score 330.33

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Expression

  Differential Expression (27)

Disease log2 FC p
glioblastoma 1.300 4.2e-05
acute quadriplegic myopathy -1.004 1.6e-04
aldosterone-producing adenoma -1.430 6.7e-03
atypical teratoid / rhabdoid tumor 1.100 1.6e-02
breast carcinoma 1.800 2.0e-03
cutaneous lupus erythematosus -1.100 1.6e-02
cystic fibrosis -1.887 3.7e-06
ductal carcinoma in situ 1.300 1.0e-02
ependymoma 2.000 5.7e-10
gastric carcinoma 1.200 3.7e-02
group 3 medulloblastoma -1.100 2.9e-02
hereditary spastic paraplegia 1.145 1.6e-03
inflammatory breast cancer -1.400 1.5e-03
interstitial cystitis -1.400 3.6e-03
intraductal papillary-mucinous adenoma (... 1.100 4.2e-03
invasive ductal carcinoma 1.200 2.9e-02
lung adenocarcinoma 1.300 9.2e-06
lung cancer 2.700 4.1e-06
malignant mesothelioma 4.300 8.0e-09
medulloblastoma, large-cell -1.700 4.1e-05
ovarian cancer 1.500 2.7e-04
pediatric high grade glioma 1.100 1.4e-02
pituitary cancer -2.000 1.5e-05
psoriasis -1.200 1.8e-07
tuberculosis -1.300 4.3e-02
type 2 diabetes -1.151 5.0e-03
urothelial carcinoma -1.400 9.9e-03

Gene RIF (111)

AA Sequence

MPADIMEKNSSSPVAATPASVNTTPDKPKTASEHRKSSKPIMEKRRRARINESLSQLKTLILDALKKDSS      1 - 70
RHSKLEKADILEMTVKHLRNLQRAQMTAALSTDPSVLGKYRAGFSECMNEVTRFLSTCEGVNTEVRTRLL     71 - 140
GHLANCMTQINAMTYPGQPHPALQAPPPPPPGPGGPQHAPFAPPPPLVPIPGGAAPPPGGAPCKLGSQAG    141 - 210
EAAKVFGGFQVVPAPDGQFAFLIPNGAFAHSGPVIPVYTSNSGTSVGPNAVSPSSGPSLTADSMWRPWRN    211 - 280
//

Text Mined References (133)

PMID Year Title