Property Summary

NCBI Gene PubMed Count 317
Grant Count 274
R01 Count 186
Funding $27,511,967.56
PubMed Score 1336.30
PubTator Score 834.21

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
osteosarcoma 1.207 0.000
intraductal papillary-mucinous carcinoma... 1.100 0.019
ovarian cancer 1.900 0.001

Synonym

Accession Q14457 B2R6N7 O75595 Q9UNA8
Symbols ATG6
VPS30
beclin1

Gene

PANTHER Protein Class (2)

PDB

2P1L   2PON   3DVU   4DDP   4MI8   5EFM   5HHE  

Gene RIF (276)

PMID Text
27468577 Decreased miR-124-3p expression prompted breast cancer cell progression mainly by enhancing the expression of autophagy related protein, Beclin-1.
27468561 Suggest high expression of Beclin-1 in alveolar macrophages could be a novel biomarker for predicting anti-TB outcomes.
26988033 Beclin-1 role in antiviral immune responses: USP19 modulates antiviral immune responses by deubiquitinating Beclin-1.
26937551 Data suggest that flexible helical domain of BECN1 undergoes a binding-associated disorder-to-helix transition; conserved residues critical for this interaction are essential for autophagy (here, autophagy induced by switching cells to EBSS).
26929373 Both transfected and endogenous beclin 1 coimmunoprecipitated with vGPCR.
26756998 The high levels of beclin-1 observed in hepatitis tissues suggest a central role for autophagy that may limit liver damage and interact with progression to cancer where beclin-1 later on becomes suppressed in aggressive HCC cases.
26739061 Astemizole-histamine induces Beclin-1-independent autophagy by targeting p53-dependent crosstalk between autophagy and apoptosis.
26722036 Autophagy status, as determined by combined LC3, Beclin 1 and p62 expression, might be independently associated with poor survival in patients with gastric cancer.
26708607 Collectively these results indicate miR-30a and its downstream target gene Beclin-1 can be used in treatment of osteosarcoma chemo-resistance in the future.
26617774 Suggest that Beclin 1 and p62 could serve as potential indicators for the prognosis of patients with non-small cell lung cancer.
More...

AA Sequence

MEGSKTSNNSTMQVSFVCQRCSQPLKLDTSFKILDRVTIQELTAPLLTTAQAKPGETQEEETNSGEEPFI      1 - 70
ETPRQDGVSRRFIPPARMMSTESANSFTLIGEASDGGTMENLSRRLKVTGDLFDIMSGQTDVDHPLCEEC     71 - 140
TDTLLDQLDTQLNVTENECQNYKRCLEILEQMNEDDSEQLQMELKELALEEERLIQELEDVEKNRKIVAE    141 - 210
NLEKVQAEAERLDQEEAQYQREYSEFKRQQLELDDELKSVENQMRYAQTQLDKLKKTNVFNATFHIWHSG    211 - 280
QFGTINNFRLGRLPSVPVEWNEINAAWGQTVLLLHALANKMGLKFQRYRLVPYGNHSYLESLTDKSKELP    281 - 350
LYCSGGLRFFWDNKFDHAMVAFLDCVQQFKEEVEKGETRFCLPYRMDVEKGKIEDTGGSGGSYSIKTQFN    351 - 420
SEEQWTKALKFMLTNLKWGLAWVSSQFYNK                                            421 - 450
//

Text Mined References (325)

PMID Year Title
27468577 2016 Decreased miR-124-3p Expression Prompted Breast Cancer Cell Progression Mainly by Targeting Beclin-1.
27468561 2016 High Beclin-1 Expression in Human Alveolar Macrophage Significantly Correlate with the Bacteriologic Sterilization in Pulmonary Tuberculosis Patients.
26988033 2016 USP19 modulates autophagy and antiviral immune responses by deubiquitinating Beclin-1.
26937551 2016 Conformational Flexibility Enables the Function of a BECN1 Region Essential for Starvation-Mediated Autophagy.
26929373 2016 Endolysosomal trafficking of viral G protein-coupled receptor functions in innate immunity and control of viral oncogenesis.
26756998 2016 Expression of Beclin-1, an autophagy-related marker, in chronic hepatitis and hepatocellular carcinoma and its relation with apoptotic markers.
26739061 2016 Astemizole-Histamine induces Beclin-1-independent autophagy by targeting p53-dependent crosstalk between autophagy and apoptosis.
26722036 2016 Clinicopathological Correlations of Autophagy-related Proteins LC3, Beclin 1 and p62 in Gastric Cancer.
26708607 2016 MicroRNA-30a downregulation contributes to chemoresistance of osteosarcoma cells through activating Beclin-1-mediated autophagy.
26617774 2015 Beclin 1 and p62 expression in non-small cell lung cancer: relation with malignant behaviors and clinical outcome.
More...