Property Summary

NCBI Gene PubMed Count 371
PubMed Score 1555.99
PubTator Score 834.21

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
intraductal papillary-mucinous carcinoma... 1.100 1.9e-02
osteosarcoma 1.207 3.4e-05
ovarian cancer -1.700 4.8e-05

Protein-protein Interaction (4)

Gene RIF (322)

AA Sequence

MEGSKTSNNSTMQVSFVCQRCSQPLKLDTSFKILDRVTIQELTAPLLTTAQAKPGETQEEETNSGEEPFI      1 - 70
ETPRQDGVSRRFIPPARMMSTESANSFTLIGEASDGGTMENLSRRLKVTGDLFDIMSGQTDVDHPLCEEC     71 - 140
TDTLLDQLDTQLNVTENECQNYKRCLEILEQMNEDDSEQLQMELKELALEEERLIQELEDVEKNRKIVAE    141 - 210
NLEKVQAEAERLDQEEAQYQREYSEFKRQQLELDDELKSVENQMRYAQTQLDKLKKTNVFNATFHIWHSG    211 - 280
QFGTINNFRLGRLPSVPVEWNEINAAWGQTVLLLHALANKMGLKFQRYRLVPYGNHSYLESLTDKSKELP    281 - 350
LYCSGGLRFFWDNKFDHAMVAFLDCVQQFKEEVEKGETRFCLPYRMDVEKGKIEDTGGSGGSYSIKTQFN    351 - 420
SEEQWTKALKFMLTNLKWGLAWVSSQFYNK                                            421 - 450
//

Text Mined References (379)

PMID Year Title