Property Summary

NCBI Gene PubMed Count 69
Grant Count 27
R01 Count 19
Funding $1,263,688.92
PubMed Score 127.69
PubTator Score 94.48

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
psoriasis 1.100 0.002
osteosarcoma 2.221 0.000
interstitial cystitis -1.400 0.000
ductal carcinoma in situ 2.100 0.040
invasive ductal carcinoma 2.400 0.046

Gene RIF (37)

PMID Text
26617853 Suggest close relationship between Grb7 gene amplification and GRB7 protein overexpression in human ovarian cancer. Immunohistochemistry might have limited diagnostic value in these tumors compared to fluorescence in situ hybridization.
25182704 Grb7 was found to be significantly related to the biological classification of breast cancer
24637751 apo Grb7 SH2 domain crystallized in the trigonal space group P63, whereas the G7-B1-Grb7 SH2 domain complex crystallized in the monoclinic space group P21
24464577 The data reveal that Grb7 plays an important role in breast cancer progression, beyond the context of HER2+ve cell types
24089360 Grb7 protein interacts with Filamin-a, an actin-crosslinking component of the cell cytoskeleton.
23743201 Data suggest that calmodulin controls Grb7-mediated cell migration.
22811067 Data propose the phosphorylation state of Grb7-SH2 domain tyrosine residues could control Grb7 dimerization, and dimerization may be an important regulatory step in Grb7 binding to RTKs such as erbB2.
22673522 propose that CaM inhibits the translocation of Grb7 to the nucleus after binding to its CaM-BD and therefore occluding its overlapping NLS
22584052 GRB7 is a context-dependent oncogene, which modulates the ERBB2 signaling pathway through enhanced phosphorylation of ERBB2 and Akt.
22253820 A series of Grb7 SH2 domain-binding nonphosphorylated peptides in the yeast two-hybrid system, were identified.
More...

AA Sequence

MELDLSPPHLSSSPEDLCPAPGTPPGTPRPPDTPLPEEVKRSQPLLIPTTGRKLREEERRATSLPSIPNP      1 - 70
FPELCSPPSQSPILGGPSSARGLLPRDASRPHVVKVYSEDGACRSVEVAAGATARHVCEMLVQRAHALSD     71 - 140
ETWGLVECHPHLALERGLEDHESVVEVQAAWPVGGDSRFVFRKNFAKYELFKSSPHSLFPEKMVSSCLDA    141 - 210
HTGISHEDLIQNFLNAGSFPEIQGFLQLRGSGRKLWKRFFCFLRRSGLYYSTKGTSKDPRHLQYVADVNE    211 - 280
SNVYVVTQGRKLYGMPTDFGFCVKPNKLRNGHKGLRIFCSEDEQSRTCWLAAFRLFKYGVQLYKNYQQAQ    281 - 350
SRHLHPSCLGSPPLRSASDNTLVAMDFSGHAGRVIENPREALSVALEEAQAWRKKTNHRLSLPMPASGTS    351 - 420
LSAAIHRTQLWFHGRISREESQRLIGQQGLVDGLFLVRESQRNPQGFVLSLCHLQKVKHYLILPSEEEGR    421 - 490
LYFSMDDGQTRFTDLLQLVEFHQLNRGILPCLLRHCCTRVAL                                491 - 532
//

Text Mined References (75)

PMID Year Title
26871637 2016 Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing.
26617853 2015 Grb7 gene amplification and protein expression by FISH and IHC in ovarian cancer.
25814554 2015 Phospho-tyrosine dependent protein-protein interaction network.
25416956 2014 A proteome-scale map of the human interactome network.
25182704 2014 Validation of analytical breast cancer microarray analysis in medical laboratory.
24728074 2014 Enhanced prediction of Src homology 2 (SH2) domain binding potentials using a fluorescence polarization-derived c-Met, c-Kit, ErbB, and androgen receptor interactome.
24637751 2014 Preparation of crystals for characterizing the Grb7 SH2 domain before and after complex formation with a bicyclic peptide antagonist.
24464577 2014 Context-dependent role of Grb7 in HER2+ve and triple-negative breast cancer cell lines.
24189400 2013 Perturbation of the mutated EGFR interactome identifies vulnerabilities and resistance mechanisms.
24089360 2013 Grb7 and Filamin-a associate and are colocalized to cell membrane ruffles upon EGF stimulation.
More...