Property Summary

NCBI Gene PubMed Count 46
PubMed Score 42.48
PubTator Score 35.62

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (22)

Disease log2 FC p
astrocytic glioma -2.300 8.1e-03
Astrocytoma, Pilocytic -1.300 2.3e-02
atypical teratoid / rhabdoid tumor -2.000 4.0e-02
cystic fibrosis 1.769 1.2e-04
ependymoma -2.100 3.8e-02
gastric cancer 1.500 3.4e-03
glioblastoma -2.100 1.4e-02
group 4 medulloblastoma -2.500 2.9e-03
intraductal papillary-mucinous adenoma (... -4.100 2.0e-06
intraductal papillary-mucinous carcinoma... -3.500 8.2e-04
intraductal papillary-mucinous neoplasm ... -2.800 7.1e-03
lung adenocarcinoma 1.100 1.1e-02
lung cancer 2.400 2.7e-03
malignant mesothelioma -3.700 1.5e-08
medulloblastoma, large-cell -2.700 9.8e-03
oligodendroglioma -2.600 5.3e-03
osteosarcoma -1.909 1.7e-02
pancreatic cancer 1.800 1.4e-04
pancreatic carcinoma 1.800 1.4e-04
pancreatic ductal adenocarcinoma liver m... -1.534 2.0e-02
psoriasis -1.300 1.3e-06
subependymal giant cell astrocytoma 2.985 2.5e-03

Protein-protein Interaction (2)

Gene RIF (21)

AA Sequence

MTTSLQDGQSAASRAAARDSPLAAQVCGAAQGRGDAHDLAPAPWLHARALLPLPDGTRGCAADRRKKKDL      1 - 70
DVPEMPSIPNPFPELCCSPFTSVLSADLFPKANSRKKQVIKVYSEDETSRALDVPSDITARDVCQLLILK     71 - 140
NHYIDDHSWTLFEHLPHIGVERTIEDHELVIEVLSNWGIEEENKLYFRKNYAKYEFFKNPMYFFPEHMVS    141 - 210
FATETNGEISPTQILQMFLSSSTYPEIHGFLHAKEQGKKSWKKIYFFLRRSGLYFSTKGTSKEPRHLQFF    211 - 280
SEFGNSDIYVSLAGKKKHGAPTNYGFCFKPNKAGGPRDLKMLCAEEEQSRTCWVTAIRLLKYGMQLYQNY    281 - 350
MHPYQGRSGCSSQSISPMRSISENSLVAMDFSGQKSRVIENPTEALSVAVEEGLAWRKKGCLRLGTHGSP    351 - 420
TASSQSSATNMAIHRSQPWFHHKISRDEAQRLIIQQGLVDGVFLVRDSQSNPKTFVLSMSHGQKIKHFQI    421 - 490
IPVEDDGEMFHTLDDGHTRFTDLIQLVEFYQLNKGVLPCKLKHYCARIAL                        491 - 540
//

Text Mined References (52)

PMID Year Title