Property Summary

NCBI Gene PubMed Count 42
PubMed Score 41.44
PubTator Score 35.62

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count P-value
malignant mesothelioma 3163 1.52429401463338E-8
intraductal papillary-mucinous adenoma (IPMA) 2956 2.00044728878062E-6
medulloblastoma 1524 4.79609249411325E-5
lung cancer 4473 7.98168061985106E-5
cystic fibrosis 1670 1.18821283419226E-4
pancreatic carcinoma 567 1.36138107635363E-4
pancreatic cancer 2300 1.36138107635365E-4
psoriasis 6685 1.6901020371563E-4
intraductal papillary-mucinous carcinoma (IPMC) 2988 8.2148926146741E-4
subependymal giant cell astrocytoma 2287 0.00246186848208726
gastric cancer 436 0.00342997012571179
oligodendroglioma 2849 0.00533751539628438
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00705514053098834
astrocytic glioma 2241 0.00809175736890789
medulloblastoma, large-cell 6234 0.00978376824978396
glioblastoma 5572 0.0141471363226915
osteosarcoma 7933 0.0171522635921538
pancreatic ductal adenocarcinoma liver metastasis 1795 0.0203260972790425
lung adenocarcinoma 2714 0.0228363123435864
pilocytic astrocytoma 3086 0.0234890069858672
ependymoma 2514 0.0378031813055988
atypical teratoid / rhabdoid tumor 4369 0.0401377126090355
Disease Target Count Z-score Confidence
Silver-Russell syndrome 37 3.147 1.6

Expression

Synonym

Accession Q14449 B7Z7F9 Q7Z6I1
Symbols

Gene

PDB

4K81   2AUH   2AUG  

  Ortholog (13)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA Inparanoid
Rat OMA Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA Inparanoid
Pig OMA EggNOG
Platypus OMA EggNOG Inparanoid
Chicken OMA Inparanoid
Anole lizard OMA Inparanoid
Xenopus OMA EggNOG
Zebrafish OMA EggNOG

Gene RIF (17)

PMID Text
24535599 Phosphorylation of Grb14 BPS domain by GSK-3 correlates with complex forming of Grb14 and insulin receptor.
24273167 Modulation of mouse rod photoreceptor responses by Grb14 protein.
23670221 Genes within recently identified loci associated with waist-hip ratio (WHR) exhibit fat depot-specific mRNA expression, which correlates with obesity-related traits. Adipose tissue (AT) mRNA expression of 6 genes (TBX15/WARS2, STAB1, PIGC, ZNRF3, GRB14
23457408 ANKRD55 rs459193 and GRB14 rs13389219 associate with insulin resistance.
23190452 Studies indicate that insulin receptor (IR) and IGF Type 1 Receptor (IGFR) have been identified as important partners of Grb10/14 and SH2B1/B2 adaptors.
22948154 Grb14 is the first negative regulator of CEACAM3-initiated bacterial phagocytosis and might help to focus granulocyte responses to the subcellular sites of pathogen-host cell contact
22158039 A new role for Grb14 in finely tuning receptor signaling and modulating thyroid cancer progression.
20935629 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20932831 Grb14 was recruited to FGFR1 into a trimeric complex containing also phospholipase C gamma
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
More...

AA Sequence

MTTSLQDGQSAASRAAARDSPLAAQVCGAAQGRGDAHDLAPAPWLHARALLPLPDGTRGCAADRRKKKDL      1 - 70
DVPEMPSIPNPFPELCCSPFTSVLSADLFPKANSRKKQVIKVYSEDETSRALDVPSDITARDVCQLLILK     71 - 140
NHYIDDHSWTLFEHLPHIGVERTIEDHELVIEVLSNWGIEEENKLYFRKNYAKYEFFKNPMYFFPEHMVS    141 - 210
FATETNGEISPTQILQMFLSSSTYPEIHGFLHAKEQGKKSWKKIYFFLRRSGLYFSTKGTSKEPRHLQFF    211 - 280
SEFGNSDIYVSLAGKKKHGAPTNYGFCFKPNKAGGPRDLKMLCAEEEQSRTCWVTAIRLLKYGMQLYQNY    281 - 350
MHPYQGRSGCSSQSISPMRSISENSLVAMDFSGQKSRVIENPTEALSVAVEEGLAWRKKGCLRLGTHGSP    351 - 420
TASSQSSATNMAIHRSQPWFHHKISRDEAQRLIIQQGLVDGVFLVRDSQSNPKTFVLSMSHGQKIKHFQI    421 - 490
IPVEDDGEMFHTLDDGHTRFTDLIQLVEFYQLNKGVLPCKLKHYCARIAL                        491 - 540
//

Text Mined References (48)

PMID Year Title
24954895 2014 Gene-age interactions in blood pressure regulation: a large-scale investigation with the CHARGE, Global BPgen, and ICBP Consortia.
24535599 2014 Phosphorylation of Grb14 BPS domain by GSK-3 correlates with complex forming of Grb14 and insulin receptor.
24509480 2014 Genome-wide trans-ancestry meta-analysis provides insight into the genetic architecture of type 2 diabetes susceptibility.
24455749 2013 Identifying candidate genes for Type 2 Diabetes Mellitus and obesity through gene expression profiling in multiple tissues or cells.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24273167 2014 Modulation of mouse rod photoreceptor responses by Grb14 protein.
23827965 2013 Pleiotropic effects of obesity-susceptibility loci on metabolic traits: a meta-analysis of up to 37,874 individuals.
23754948 2013 Sex-stratified genome-wide association studies including 270,000 individuals show sexual dimorphism in genetic loci for anthropometric traits.
23670221 2014 Fat depot-specific mRNA expression of novel loci associated with waist-hip ratio.
23457408 2013 Type 2 diabetes risk alleles near BCAR1 and in ANK1 associate with decreased ?-cell function whereas risk alleles near ANKRD55 and GRB14 associate with decreased insulin sensitivity in the Danish Inter99 cohort.
More...