Property Summary

NCBI Gene PubMed Count 42
Grant Count 19
R01 Count 16
Funding $947,750.84
PubMed Score 41.44
PubTator Score 35.62

Knowledge Summary

Patent

No data available

Expression

Gene RIF (17)

PMID Text
24535599 Phosphorylation of Grb14 BPS domain by GSK-3 correlates with complex forming of Grb14 and insulin receptor.
24273167 Modulation of mouse rod photoreceptor responses by Grb14 protein.
23670221 Genes within recently identified loci associated with waist-hip ratio (WHR) exhibit fat depot-specific mRNA expression, which correlates with obesity-related traits. Adipose tissue (AT) mRNA expression of 6 genes (TBX15/WARS2, STAB1, PIGC, ZNRF3, GRB14
23457408 ANKRD55 rs459193 and GRB14 rs13389219 associate with insulin resistance.
23190452 Studies indicate that insulin receptor (IR) and IGF Type 1 Receptor (IGFR) have been identified as important partners of Grb10/14 and SH2B1/B2 adaptors.
22948154 Grb14 is the first negative regulator of CEACAM3-initiated bacterial phagocytosis and might help to focus granulocyte responses to the subcellular sites of pathogen-host cell contact
22158039 A new role for Grb14 in finely tuning receptor signaling and modulating thyroid cancer progression.
20935629 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20932831 Grb14 was recruited to FGFR1 into a trimeric complex containing also phospholipase C gamma
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
More...

AA Sequence

MTTSLQDGQSAASRAAARDSPLAAQVCGAAQGRGDAHDLAPAPWLHARALLPLPDGTRGCAADRRKKKDL      1 - 70
DVPEMPSIPNPFPELCCSPFTSVLSADLFPKANSRKKQVIKVYSEDETSRALDVPSDITARDVCQLLILK     71 - 140
NHYIDDHSWTLFEHLPHIGVERTIEDHELVIEVLSNWGIEEENKLYFRKNYAKYEFFKNPMYFFPEHMVS    141 - 210
FATETNGEISPTQILQMFLSSSTYPEIHGFLHAKEQGKKSWKKIYFFLRRSGLYFSTKGTSKEPRHLQFF    211 - 280
SEFGNSDIYVSLAGKKKHGAPTNYGFCFKPNKAGGPRDLKMLCAEEEQSRTCWVTAIRLLKYGMQLYQNY    281 - 350
MHPYQGRSGCSSQSISPMRSISENSLVAMDFSGQKSRVIENPTEALSVAVEEGLAWRKKGCLRLGTHGSP    351 - 420
TASSQSSATNMAIHRSQPWFHHKISRDEAQRLIIQQGLVDGVFLVRDSQSNPKTFVLSMSHGQKIKHFQI    421 - 490
IPVEDDGEMFHTLDDGHTRFTDLIQLVEFYQLNKGVLPCKLKHYCARIAL                        491 - 540
//

Text Mined References (48)

PMID Year Title
24954895 2014 Gene-age interactions in blood pressure regulation: a large-scale investigation with the CHARGE, Global BPgen, and ICBP Consortia.
24535599 2014 Phosphorylation of Grb14 BPS domain by GSK-3 correlates with complex forming of Grb14 and insulin receptor.
24509480 2014 Genome-wide trans-ancestry meta-analysis provides insight into the genetic architecture of type 2 diabetes susceptibility.
24455749 2013 Identifying candidate genes for Type 2 Diabetes Mellitus and obesity through gene expression profiling in multiple tissues or cells.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24273167 2014 Modulation of mouse rod photoreceptor responses by Grb14 protein.
23827965 2013 Pleiotropic effects of obesity-susceptibility loci on metabolic traits: a meta-analysis of up to 37,874 individuals.
23754948 2013 Sex-stratified genome-wide association studies including 270,000 individuals show sexual dimorphism in genetic loci for anthropometric traits.
23670221 2014 Fat depot-specific mRNA expression of novel loci associated with waist-hip ratio.
23457408 2013 Type 2 diabetes risk alleles near BCAR1 and in ANK1 associate with decreased ?-cell function whereas risk alleles near ANKRD55 and GRB14 associate with decreased insulin sensitivity in the Danish Inter99 cohort.
More...