Property Summary

NCBI Gene PubMed Count 11
PubMed Score 11.55
PubTator Score 2.53

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (1)

Disease log2 FC p
ovarian cancer -1.300 0.000

Synonym

Accession Q14442 B2RAA4
Symbols GPI-H

Gene

Gene RIF (1)

PMID Text
18187620 Knockdown of phosphatidylinositol glycan anchor biosynthesis, class H (PIGH) by siRNA inhibits HIV-1 replication in HeLa-derived TZM-bl cells

AA Sequence

MEDERSFSDICGGRLALQRRYYSPSCREFCLSCPRLSLRSLTAVTCTVWLAAYGLFTLCENSMILSAAIF      1 - 70
ITLLGLLGYLHFVKIDQETLLIIDSLGIQMTSSYASGKESTTFIEMGKVKDIVINEAIYMQKVIYYLCIL     71 - 140
LKDPVEPHGISQVVPVFQSAKPRLDCLIEVYRSCQEILAHQKATSTSP                          141 - 188
//

Text Mined References (13)

PMID Year Title
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11102867 2000 Dissecting and manipulating the pathway for glycosylphos-phatidylinositol-anchor biosynthesis.
10944123 2000 Initial enzyme for glycosylphosphatidylinositol biosynthesis requires PIG-P and is regulated by DPM2.
9463366 1998 The first step of glycosylphosphatidylinositol biosynthesis is mediated by a complex of PIG-A, PIG-H, PIG-C and GPI1.
More...