Property Summary

NCBI Gene PubMed Count 6
PubMed Score 235.41
PubTator Score 1.11

Knowledge Summary

Patent (14,206)

Expression

  Differential Expression (9)

Disease log2 FC p
Gaucher disease type 1 -1.100 2.5e-02
interstitial cystitis 1.300 1.8e-03
malignant mesothelioma -1.500 1.4e-06
medulloblastoma, large-cell -1.200 1.0e-03
osteosarcoma 1.512 1.8e-05
ovarian cancer 1.100 5.5e-04
pituitary cancer -1.500 4.5e-05
posterior fossa group B ependymoma -1.400 2.7e-07
primary pancreatic ductal adenocarcinoma 1.037 9.5e-03

Gene RIF (2)

AA Sequence

MGHNGSWISPNASEPHNASGAEAAGVNRSALGEFGEAQLYRQFTTTVQVVIFIGSLLGNFMVLWSTCRTT      1 - 70
VFKSVTNRFIKNLACSGICASLVCVPFDIILSTSPHCCWWIYTMLFCKVVKFLHKVFCSVTILSFPAIAL     71 - 140
DRYYSVLYPLERKISDAKSRELVMYIWAHAVVASVPVFAVTNVADIYATSTCTEVWSNSLGHLVYVLVYN    141 - 210
ITTVIVPVVVVFLFLILIRRALSASQKKKVIIAALRTPQNTISIPYASQREAELHATLLSMVMVFILCSV    211 - 280
PYATLVVYQTVLNVPDTSVFLLLTAVWLPKVSLLANPVLFLTVNKSVRKCLIGTLVQLHHRYSRRNVVST    281 - 350
GSGMAEASLEPSIRSGSQLLEMFHIGQQQIFKPTEDEEESEAKYIGSADFQAKEIFSTCLEGEQGPQFAP    351 - 420
SAPPLSTVDSVSQVAPAAPVEPETFPDKYSLQFGFGPFELPPQWLSETRNSKKRLLPPLGNTPEELIQTK    421 - 490
VPKVGRVERKMSRNNKVSIFPKVDS                                                 491 - 515
//

Text Mined References (8)

PMID Year Title