Property Summary

NCBI Gene PubMed Count 6
Grant Count 36
R01 Count 23
Funding $8,456,786.62
PubMed Score 217.58
PubTator Score 1.11

Knowledge Summary

Patent (14,206)

Expression

  Differential Expression (9)

Disease log2 FC p
malignant mesothelioma -1.500 0.000
osteosarcoma 1.512 0.000
medulloblastoma, large-cell -1.200 0.001
primary pancreatic ductal adenocarcinoma 1.037 0.010
interstitial cystitis 1.300 0.002
posterior fossa group B ependymoma -1.400 0.000
ovarian cancer 1.100 0.001
Gaucher disease type 1 -1.100 0.025
pituitary cancer -1.500 0.000

Gene RIF (2)

PMID Text
20677014 Observational study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MGHNGSWISPNASEPHNASGAEAAGVNRSALGEFGEAQLYRQFTTTVQVVIFIGSLLGNFMVLWSTCRTT      1 - 70
VFKSVTNRFIKNLACSGICASLVCVPFDIILSTSPHCCWWIYTMLFCKVVKFLHKVFCSVTILSFPAIAL     71 - 140
DRYYSVLYPLERKISDAKSRELVMYIWAHAVVASVPVFAVTNVADIYATSTCTEVWSNSLGHLVYVLVYN    141 - 210
ITTVIVPVVVVFLFLILIRRALSASQKKKVIIAALRTPQNTISIPYASQREAELHATLLSMVMVFILCSV    211 - 280
PYATLVVYQTVLNVPDTSVFLLLTAVWLPKVSLLANPVLFLTVNKSVRKCLIGTLVQLHHRYSRRNVVST    281 - 350
GSGMAEASLEPSIRSGSQLLEMFHIGQQQIFKPTEDEEESEAKYIGSADFQAKEIFSTCLEGEQGPQFAP    351 - 420
SAPPLSTVDSVSQVAPAAPVEPETFPDKYSLQFGFGPFELPPQWLSETRNSKKRLLPPLGNTPEELIQTK    421 - 490
VPKVGRVERKMSRNNKVSIFPKVDS                                                 491 - 515
//

Text Mined References (6)

PMID Year Title
20677014 2010 An approach based on a genome-wide association study reveals candidate loci for narcolepsy.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
16712791 2006 Identification of intrahepatic cholangiocarcinoma related genes by comparison with normal liver tissues using expressed sequence tags.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
7893747 1995 cDNA cloning of a putative G protein-coupled receptor from brain.