Property Summary

NCBI Gene PubMed Count 43
Grant Count 75
R01 Count 42
Funding $11,166,334.48
PubMed Score 622.28
PubTator Score 79.21

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q14435 Q53TG9 Q7Z476
Symbols HHS
HFTC
GalNAc-T3

Gene

PANTHER Protein Class (2)

Gene RIF (28)

PMID Text
26637460 Two microRNAs (miRNAs), miR-17-3p and miR-221, which target GalNAc transferase 3 (GALNT3) mRNA, are rapidly downregulated in human alveolar basal epithelial cells during the early stage of influenza A virus infection.
25630622 MGAT5 expression is a potential independent adverse prognostic biomarker for recurrence and survival of patients with ccRCC after nephrectomy.
25249269 hyperphosphatemic familial tumoral calcinosis and hyperphosphatemic hyperostosis syndrome caused by a novel GALNT3 mutation
24504219 Data are indicative for a strong oncogenic potential of the GALNT3 gene in advanced EOC and identify this transferase as a novel EOC biomarker.
24431446 GalNac transferase transgenic knock-out mice neurons have significantly increased rates of axon degeneration.
24045674 Polymorphisms of rs1863196, rs6710518, rs4667492, rs1349321 and rs6721582 (GALNT3) are associated with bone mineral density.GALNT3 may play a role in genetic susceptibility to postmenopausal osteoporosis in Chinese womeh.
24038392 we integrated different computational tools to perform the in silico analysis of clinically significant mutations (nsSNPs/single amino acid change) at both functional and structural levels, found in human GALNT3, GALNT8, GALNT12, and GALNT13 genes.
23799843 N-acetylgalactosaminyltransferases-3 expression independently predicts high-grade tumour and poor prognosis in patients with renal cell carcinomas.
23659732 Our data suggest that GalNAc-T3 expression may be a useful indicator of tumor differentiation in thyroid carcinomas.
21625220 GalNAc-T3 is likely involved in pancreatic carcinogenesis
More...

AA Sequence

MAHLKRLVKLHIKRHYHKKFWKLGAVIFFFIIVLVLMQREVSVQYSKEESRMERNMKNKNKMLDLMLEAV      1 - 70
NNIKDAMPKMQIGAPVRQNIDAGERPCLQGYYTAAELKPVLDRPPQDSNAPGASGKAFKTTNLSVEEQKE     71 - 140
KERGEAKHCFNAFASDRISLHRDLGPDTRPPECIEQKFKRCPPLPTTSVIIVFHNEAWSTLLRTVHSVLY    141 - 210
SSPAILLKEIILVDDASVDEYLHDKLDEYVKQFSIVKIVRQRERKGLITARLLGATVATAETLTFLDAHC    211 - 280
ECFYGWLEPLLARIAENYTAVVSPDIASIDLNTFEFNKPSPYGSNHNRGNFDWSLSFGWESLPDHEKQRR    281 - 350
KDETYPIKTPTFAGGLFSISKEYFEYIGSYDEEMEIWGGENIEMSFRVWQCGGQLEIMPCSVVGHVFRSK    351 - 420
SPHSFPKGTQVIARNQVRLAEVWMDEYKEIFYRRNTDAAKIVKQKAFGDLSKRFEIKHRLQCKNFTWYLN    421 - 490
NIYPEVYVPDLNPVISGYIKSVGQPLCLDVGENNQGGKPLIMYTCHGLGGNQYFEYSAQHEIRHNIQKEL    491 - 560
CLHAAQGLVQLKACTYKGHKTVVTGEQIWEIQKDQLLYNPFLKMCLSANGEHPSLVSCNPSDPLQKWILS    561 - 630
QND                                                                       631 - 633
//

Text Mined References (46)

PMID Year Title
26637460 2015 Influenza A Virus-Induced Expression of a GalNAc Transferase, GALNT3, via MicroRNAs Is Required for Enhanced Viral Replication.
25630622 2015 ?1,6-N-acetylglucosaminyltransferase V predicts recurrence and survival of patients with clear-cell renal cell carcinoma after surgical resection.
25416956 2014 A proteome-scale map of the human interactome network.
25249269 2014 Long-term clinical outcome and phenotypic variability in hyperphosphatemic familial tumoral calcinosis and hyperphosphatemic hyperostosis syndrome caused by a novel GALNT3 mutation; case report and review of the literature.
24945404 2014 Phenotypic dissection of bone mineral density reveals skeletal site specificity and facilitates the identification of novel loci in the genetic regulation of bone mass attainment.
24504219 2014 Role of the polypeptide N-acetylgalactosaminyltransferase 3 in ovarian cancer progression: possible implications in abnormal mucin O-glycosylation.
24431446 2014 Neuronal expression of GalNAc transferase is sufficient to prevent the age-related neurodegenerative phenotype of complex ganglioside-deficient mice.
24045674 2014 Association of GALNT3 gene polymorphisms with bone mineral density in Chinese postmenopausal women: the Peking Vertebral Fracture study.
24038392 2014 Clinically significant missense variants in human GALNT3, GALNT8, GALNT12, and GALNT13 genes: intriguing in silico findings.
23799843 2013 Polypeptide N-acetylgalactosaminyl transferase 3 independently predicts high-grade tumours and poor prognosis in patients with renal cell carcinomas.
More...