Property Summary

Ligand Count 130
NCBI Gene PubMed Count 55
PubMed Score 125.72
PubTator Score 92.49

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (8)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.0
Kidney cancer 2613 0.0 0.5
Disease Target Count Z-score Confidence
Heart conduction disease 83 0.0 1.7
Rheumatoid arthritis 1191 0.0 1.4
Disease Target Count Z-score Confidence
Impotence 46 3.134 1.6
Acrodysostosis 12 3.028 1.5

Expression

  Differential Expression (12)

Disease log2 FC p
Astrocytoma, Pilocytic -1.100 3.4e-03
colon cancer -2.900 6.8e-05
diabetes mellitus -1.200 2.6e-02
ependymoma 1.800 9.5e-03
gastric carcinoma 1.600 4.5e-02
group 4 medulloblastoma -1.500 4.6e-04
interstitial cystitis 1.200 8.9e-04
intraductal papillary-mucinous adenoma (... -2.800 2.0e-04
intraductal papillary-mucinous neoplasm ... -3.000 6.1e-05
invasive ductal carcinoma -1.200 2.3e-02
medulloblastoma, large-cell -1.300 4.3e-03
ulcerative colitis -1.200 5.0e-03

Gene RIF (30)

AA Sequence

MAVPGDAARVRDKPVHSGVSQAPTAGRDCHHRADPASPRDSGCRGCWGDLVLQPLRSSRKLSSALCAGSL      1 - 70
SFLLALLVRLVRGEVGCDLEQCKEAAAAEEEEAAPGAEGGVFPGPRGGAPGGGARLSPWLQPSALLFSLL     71 - 140
CAFFWMGLYLLRAGVRLPLAVALLAACCGGEALVQIGLGVGEDHLLSLPAAGVVLSCLAAATWLVLRLRL    141 - 210
GVLMIALTSAVRTVSLISLERFKVAWRPYLAYLAGVLGILLARYVEQILPQSAEAAPREHLGSQLIAGTK    211 - 280
EDIPVFKRRRRSSSVVSAEMSGCSSKSHRRTSLPCIPREQLMGHSEWDHKRGPRGSQSSGTSITVDIAVM    281 - 350
GEAHGLITDLLADPSLPPNVCTSLRAVSNLLSTQLTFQAIHKPRVNPVTSLSENYTCSDSEESSEKDKLA    351 - 420
IPKRLRRSLPPGLLRRVSSTWTTTTSATGLPTLEPAPVRRDRSTSIKLQEAPSSSPDSWNNPVMMTLTKS    421 - 490
RSFTSSYAISAANHVKAKKQSRPGALAKISPLSSPCSSPLQGTPASSLVSKISAVQFPESADTTAKQSLG    491 - 560
SHRALTYTQSAPDLSPQILTPPVICSSCGRPYSQGNPADEPLERSGVATRTPSRTDDTAQVTSDYETNNN    561 - 630
SDSSDIVQNEDETECLREPLRKASACSTYAPETMMFLDKPILAPEPLVMDNLDSIMEQLNTWNFPIFDLV    631 - 700
ENIGRKCGRILSQVSYRLFEDMGLFEAFKIPIREFMNYFHALEIGYRDIPYHNRIHATDVLHAVWYLTTQ    701 - 770
PIPGLSTVINDHGSTSDSDSDSGFTHGHMGYVFSKTYNVTDDKYGCLSGNIPALELMALYVAAAMHDYDH    771 - 840
PGRTNAFLVATSAPQAVLYNDRSVLENHHAAAAWNLFMSRPEYNFLINLDHVEFKHFRFLVIEAILATDL    841 - 910
KKHFDFVAKFNGKVNDDVGIDWTNENDRLLVCQMCIKLADINGPAKCKELHLQWTDGIVNEFYEQGDEEA    911 - 980
SLGLPISPFMDRSAPQLANLQESFISHIVGPLCNSYDSAGLMPGKWVEDSDESGDTDDPEEEEEEAPAPN    981 - 1050
EEETCENNESPKKKTFKRRKIYCQITQHLLQNHKMWKKVIEEEQRLAGIENQSLDQTPQSHSSEQIQAIK   1051 - 1120
EEEEEKGKPRGEEIPTQKPDQ                                                    1121 - 1141
//

Text Mined References (60)

PMID Year Title