Property Summary

NCBI Gene PubMed Count 50
Grant Count 35
R01 Count 20
Funding $3,215,582.56
PubMed Score 124.29
PubTator Score 92.49

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Gene RIF (26)

PMID Text
26205238 Chemical proteomics results show that besides known interactors such as 14-3-3 family proteins, PDE3A was found to associate with a PP2A complex composed of a regulatory, scaffold and catalytic subunit.
26095046 Epigenetic regulation of phosphodiesterases 2A and 3A underlies compromised beta-adrenergic Signaling in an induced pluripotent stem cell model of dilated cardiomyopathy.
25961942 A heterozygous missense mutation in PDE3A causes autosomal dominant hypertension with brachydactyly.
25593322 PDE3A is part of a SERCA2 signaling complex in cardiac myocytes.
25403996 We found a highly significant association between PDE3A-SLCO1C1 and the clinical response to TNF blockers
24604378 the genotypic and allelic frequencies of the rs7134375 SNP are different between the Mulao and Han populations. the PDE3A rs7134375 SNP is associated with serum TG levels in the Mulao population, however, not in the Han population.
23651021 The PDE3A-SLCO1C1 locus rs3794271 SNP showed a highly significant association with anti-TNF treatment response.
23008439 PI3Kgamma coordinates the coincident signaling of the major cardiac PDE3 and PDE4 isoforms, thus orchestrating a feedback loop that prevents calcium-dependent ventricular arrhythmia.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20586925 Anagrelide suppresses megakaryocytopoiesis by reducing the expression levels of GATA-1 and FOG-1 via a PDEIII-independent mechanism that is differentiation context-specific and does not involve inhibition of MPL-mediated early signal transduction events
More...

AA Sequence

MAVPGDAARVRDKPVHSGVSQAPTAGRDCHHRADPASPRDSGCRGCWGDLVLQPLRSSRKLSSALCAGSL      1 - 70
SFLLALLVRLVRGEVGCDLEQCKEAAAAEEEEAAPGAEGGVFPGPRGGAPGGGARLSPWLQPSALLFSLL     71 - 140
CAFFWMGLYLLRAGVRLPLAVALLAACCGGEALVQIGLGVGEDHLLSLPAAGVVLSCLAAATWLVLRLRL    141 - 210
GVLMIALTSAVRTVSLISLERFKVAWRPYLAYLAGVLGILLARYVEQILPQSAEAAPREHLGSQLIAGTK    211 - 280
EDIPVFKRRRRSSSVVSAEMSGCSSKSHRRTSLPCIPREQLMGHSEWDHKRGPRGSQSSGTSITVDIAVM    281 - 350
GEAHGLITDLLADPSLPPNVCTSLRAVSNLLSTQLTFQAIHKPRVNPVTSLSENYTCSDSEESSEKDKLA    351 - 420
IPKRLRRSLPPGLLRRVSSTWTTTTSATGLPTLEPAPVRRDRSTSIKLQEAPSSSPDSWNNPVMMTLTKS    421 - 490
RSFTSSYAISAANHVKAKKQSRPGALAKISPLSSPCSSPLQGTPASSLVSKISAVQFPESADTTAKQSLG    491 - 560
SHRALTYTQSAPDLSPQILTPPVICSSCGRPYSQGNPADEPLERSGVATRTPSRTDDTAQVTSDYETNNN    561 - 630
SDSSDIVQNEDETECLREPLRKASACSTYAPETMMFLDKPILAPEPLVMDNLDSIMEQLNTWNFPIFDLV    631 - 700
ENIGRKCGRILSQVSYRLFEDMGLFEAFKIPIREFMNYFHALEIGYRDIPYHNRIHATDVLHAVWYLTTQ    701 - 770
PIPGLSTVINDHGSTSDSDSDSGFTHGHMGYVFSKTYNVTDDKYGCLSGNIPALELMALYVAAAMHDYDH    771 - 840
PGRTNAFLVATSAPQAVLYNDRSVLENHHAAAAWNLFMSRPEYNFLINLDHVEFKHFRFLVIEAILATDL    841 - 910
KKHFDFVAKFNGKVNDDVGIDWTNENDRLLVCQMCIKLADINGPAKCKELHLQWTDGIVNEFYEQGDEEA    911 - 980
SLGLPISPFMDRSAPQLANLQESFISHIVGPLCNSYDSAGLMPGKWVEDSDESGDTDDPEEEEEEAPAPN    981 - 1050
EEETCENNESPKKKTFKRRKIYCQITQHLLQNHKMWKKVIEEEQRLAGIENQSLDQTPQSHSSEQIQAIK   1051 - 1120
EEEEEKGKPRGEEIPTQKPDQ                                                    1121 - 1141
//

Text Mined References (54)

PMID Year Title
26205238 2015 Charting the interactome of PDE3A in human cells using an IBMX based chemical proteomics approach.
26095046 2015 Epigenetic Regulation of Phosphodiesterases 2A and 3A Underlies Compromised ?-Adrenergic Signaling in an iPSC Model of Dilated Cardiomyopathy.
25961942 2015 PDE3A mutations cause autosomal dominant hypertension with brachydactyly.
25593322 2015 Regulation of sarcoplasmic reticulum Ca2+ ATPase 2 (SERCA2) activity by phosphodiesterase 3A (PDE3A) in human myocardium: phosphorylation-dependent interaction of PDE3A1 with SERCA2.
25403996 2015 Association of the PDE3A-SLCO1C1 locus with the response to anti-TNF agents in psoriasis.
24604378 2014 Phosphodiesterase 3A rs7134375 single nucleotide polymorphism and serum lipid levels.
24376456 2013 Gene-alcohol interactions identify several novel blood pressure loci including a promising locus near SLC16A9.
24097068 2013 Discovery and refinement of loci associated with lipid levels.
23651021 2013 GWAS replication study confirms the association of PDE3A-SLCO1C1 with anti-TNF therapy response in rheumatoid arthritis.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
More...