Property Summary

NCBI Gene PubMed Count 179
Grant Count 28
R01 Count 14
Funding $3,775,427.45
PubMed Score 128.05
PubTator Score 149.62

Knowledge Summary

Patent

No data available

Expression

Gene RIF (142)

PMID Text
27455017 The AA genotype of the GCKR rs780094 polymorphism may increase the risk of T2D among ethnic Uygurs from Xinjiang.
27015186 We found that the PPARGC1A and PNPLA3 variants, but not the GCKR variant, were associated with NASH.
26620281 Given that acetylated GKRP may affiliate with type-2 diabetes mellitus (T2DM), understanding the mechanism of GKRP acetylation in the liver could reveal novel targets within the GK-GKRP pathway, for treating T2DM and other metabolic pathologies.
26578543 Lifestyle Intervention for Weight Loss and Cardiometabolic Changes in the Setting of Glucokinase Regulatory Protein Inhibition: Glucokinase Regulatory Protein-Leu446Pro Variant in Look AHEAD
26515422 The GCKR rs780092 variant showed opposite-directional associations with type 2 diabetes and hypertriacylglycerolaemia in a Chinese population.
26432016 Disruption of the GKRP-glucokinase complex is a promising new antidiabetic target, since it results in lower plasma glucose levels without inducing hypoglycemia[review]
26291577 interaction effects between GCKR genetic variants and the dietary MUFA:SFA ratio on lipid levels
26290326 Polymorphisms in GCKR, SLC17A1 and SLC22A12 were associated with phenotype gout in Han Chinese males.
26261636 SNPs in SORT1, CETP and GCKR were individually associated with lipid level variations in Algerian population.
26174136 rs1260326 in GCKR significantly associates with alpha-1 antitrypsin levels.
More...

AA Sequence

MPGTKRFQHVIETPEPGKWELSGYEAAVPITEKSNPLTQDLDKADAENIVRLLGQCDAEIFQEEGQALST      1 - 70
YQRLYSESILTTMVQVAGKVQEVLKEPDGGLVVLSGGGTSGRMAFLMSVSFNQLMKGLGQKPLYTYLIAG     71 - 140
GDRSVVASREGTEDSALHGIEELKKVAAGKKRVIVIGISVGLSAPFVAGQMDCCMNNTAVFLPVLVGFNP    141 - 210
VSMARNDPIEDWSSTFRQVAERMQKMQEKQKAFVLNPAIGPEGLSGSSRMKGGSATKILLETLLLAAHKT    211 - 280
VDQGIAASQRCLLEILRTFERAHQVTYSQSPKIATLMKSVSTSLEKKGHVYLVGWQTLGIIAIMDGVECI    281 - 350
HTFGADFRDVRGFLIGDHSDMFNQKAELTNQGPQFTFSQEDFLTSILPSLTEIDTVVFIFTLDDNLTEVQ    351 - 420
TIVEQVKEKTNHIQALAHSTVGQTLPIPLKKLFPSIISITWPLLFFEYEGNFIQKFQRELSTKWVLNTVS    421 - 490
TGAHVLLGKILQNHMLDLRISNSKLFWRALAMLQRFSGQSKARCIESLLRAIHFPQPLSDDIRAAPISCH    491 - 560
VQVAHEKEQVIPIALLSLLFRCSITEAQAHLAAAPSVCEAVRSALAGPGQKRTADPLEILEPDVQ         561 - 625
//

Text Mined References (182)

PMID Year Title
27455017 2016 [Association of GCKR gene polymorphisms and type 2 diabetes among ethnic Uygurs].
27015186 2016 Interactions of a PPARGC1A Variant and a PNPLA3 Variant Affect Nonalcoholic Steatohepatitis in Severely Obese Taiwanese Patients.
26620281 2015 Acetylation of glucokinase regulatory protein decreases glucose metabolism by suppressing glucokinase activity.
26578543 2016 Lifestyle Intervention for Weight Loss and Cardiometabolic Changes in the Setting of Glucokinase Regulatory Protein Inhibition: Glucokinase Regulatory Protein-Leu446Pro Variant in Look AHEAD.
26515422 2016 Discrete associations of the GCKR variant with metabolic risk in a Chinese population: longitudinal change analysis.
26432016 2015 Modulation of Glucokinase Regulatory Protein: A Double-Edged Sword?
26291577 2015 The dietary monounsaturated to saturated fatty acid ratio modulates the genetic effects of GCKR on serum lipid levels in children.
26290326 2015 Polymorphisms in GCKR, SLC17A1 and SLC22A12 were associated with phenotype gout in Han Chinese males: a case-control study.
26261636 2015 Associations of common SNPs in the SORT1, GCKR, LPL, APOA1, CETP, LDLR, APOE genes with lipid trait levels in an Algerian population sample.
26174136 2015 Three missense variants of metabolic syndrome-related genes are associated with alpha-1 antitrypsin levels.
More...