Property Summary

NCBI Gene PubMed Count 28
PubMed Score 24.97
PubTator Score 53.18

Knowledge Summary


No data available


  Disease Sources (2)

Disease Target Count P-value
non-small cell lung cancer 2798 3.85744645893868E-18
lung adenocarcinoma 2714 1.59111278558045E-13
cystic fibrosis 1670 1.79385727105268E-7
lung carcinoma 2844 1.01113121296742E-6
intraductal papillary-mucinous carcinoma (IPMC) 2988 3.07199375977542E-5
intraductal papillary-mucinous adenoma (IPMA) 2956 3.96391084941368E-5
interstitial cystitis 2299 5.79282277062098E-5
adrenocortical carcinoma 1427 8.85221375420072E-5
ovarian cancer 8492 2.0181251970625E-4
lung cancer 4473 8.06745521739931E-4
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00122313631728887
psoriasis 6685 0.00150341053225743
primary pancreatic ductal adenocarcinoma 1271 0.00211381816340257
pancreatic cancer 2300 0.00538963405711171
fibroadenoma 557 0.0266303208260163
inflammatory breast cancer 404 0.0445795909987099
Disease Target Count Z-score Confidence
Atopic dermatitis 944 0.0 1.0



Accession Q14392 Q86V06
Symbols GARP


PANTHER Protein Class (1)

  Ortholog (11)

Gene RIF (14)

26584734 since GARP functions as a transporter of transforming growth factor beta (TGFbeta), a cytokine with broad pleiotropic traits, GARP transcriptional attenuation by alternative promoters might provide a mechanism regulating peripheral TGFb
26357016 GARP deficiency leads to accumulation of sphingolipid synthesis intermediates, changes in sterol distribution, and lysosomal dysfunction.
24098777 GARP is regulated by miRNAs and controls latent TGF-beta1 production by human regulatory T cells.
23650616 we investigated in detail miR-142-3 pregulation of GARP expression in regulatory CD25(+) CD4 T cells
22278742 Findings support the idea that GARP is a new latent TGFbeta-binding protein that regulates the bioavailability of TGFbeta and provides a cell surface platform for alphaV integrin-dependent TGFbeta activation.
22070912 There are 2 independent signals, one in C11orf30 and the other in LRRC32, that are strongly associated with serum IgE levels. C11orf30-LRRC32 region may represent a common locus for atopic diseases via pathways involved in regulation of serum IgE levels
21907864 on chromosome 11q13.5 near the leucine-rich repeat containing 32 gene (LRRC32, also known as GARP) associated with asthma risk
21615933 the processing and expression of LRRC32
20237496 Observational study of gene-disease association. (HuGE Navigator)
19750484 Data show that latent TGF-beta, i.e. both LAP and mature TGF-beta, binds to GARP, which is present on the surface of stimulated Treg clones but not on Th clones.

AA Sequence

ILTFILVSAILLTTLAACCCVRRQKFNQQYKA                                          631 - 662

Text Mined References (29)

PMID Year Title
26584734 2016 Methylation of an intragenic alternative promoter regulates transcription of GARP.
26357016 2015 The GARP complex is required for cellular sphingolipid homeostasis.
25017104 2014 Genome-wide association analysis of eosinophilic esophagitis provides insight into the tissue specificity of this allergic disease.
24098777 2013 GARP is regulated by miRNAs and controls latent TGF-?1 production by human regulatory T cells.
23886662 2013 A genome-wide association study of atopic dermatitis identifies loci with overlapping effects on asthma and psoriasis.
23817571 2013 Meta-analysis of genome-wide association studies identifies ten loci influencing allergic sensitization.
23817569 2013 A genome-wide association meta-analysis of self-reported allergy identifies shared and allergy-specific susceptibility loci.
23650616 2013 miR-142-3p is involved in CD25+ CD4 T cell proliferation by targeting the expression of glycoprotein A repetitions predominant.
22278742 2012 GARP regulates the bioavailability and activation of TGF?.
22070912 2012 The C11orf30-LRRC32 region is associated with total serum IgE levels in asthmatic patients.