Property Summary

NCBI Gene PubMed Count 9
PubMed Score 0.16
PubTator Score 0.17

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
lung carcinoma 2843 3.1e-14

Expression

  Differential Expression (1)

Disease log2 FC p
lung carcinoma -1.100 3.1e-14

AA Sequence

MTSEFFAAQLRAQISDDTTHPISYYKPEFYTPVDGGTAHLSVVAEDGSAVSATSTINLYFGSKVRSPVSE      1 - 70
ILFNDEMDDFSSPNITNEFGVPPSPANFIQPGKQPLSSMCPTIMVGQDGQPPSHADHTPMPQAIIYNLWF     71 - 140
GYDVKRAVEEPRLHNQLLPNVTTVERNIDQAVTAALETRHHHTQIASTFIAVVQAIVRTAGGWAAASDSR    141 - 210
KGGEPAGY                                                                  211 - 218
//

Text Mined References (10)

PMID Year Title