Property Summary

NCBI Gene PubMed Count 9
PubMed Score 0.16
PubTator Score 0.17

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
lung carcinoma 2,844

Expression

  Differential Expression (1)

Disease log2 FC p
lung carcinoma -1.100 0.000

Synonym

Accession Q14390 A1A516 A2VCM9 Q5NV76 Q6ISH0
Symbols GGTL4

Gene

PANTHER Protein Class (2)

AA Sequence

MTSEFFAAQLRAQISDDTTHPISYYKPEFYTPVDGGTAHLSVVAEDGSAVSATSTINLYFGSKVRSPVSE      1 - 70
ILFNDEMDDFSSPNITNEFGVPPSPANFIQPGKQPLSSMCPTIMVGQDGQPPSHADHTPMPQAIIYNLWF     71 - 140
GYDVKRAVEEPRLHNQLLPNVTTVERNIDQAVTAALETRHHHTQIASTFIAVVQAIVRTAGGWAAASDSR    141 - 210
KGGEPAGY                                                                  211 - 218
//

Text Mined References (10)

PMID Year Title
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
22001757 2011 Genome-wide association study identifies loci influencing concentrations of liver enzymes in plasma.
18357469 2008 The human gamma-glutamyltransferase gene family.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10591208 1999 The DNA sequence of human chromosome 22.
9074928 1997 One-megabase sequence analysis of the human immunoglobulin lambda gene locus.
8830654 1996 Cloning and expression of a novel type (III) of human gamma-glutamyltransferase truncated mRNA.
7689219 1993 Human lung expresses unique gamma-glutamyl transpeptidase transcripts.