Property Summary

NCBI Gene PubMed Count 98
Grant Count 3
R01 Count 1
Funding $641,396.33
PubMed Score 9.76
PubTator Score 97.18

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (22)

Disease log2 FC p
gastric cancer -2.000 0.032
astrocytic glioma 2.100 0.014
ependymoma 2.400 0.034
oligodendroglioma 2.000 0.034
osteosarcoma 2.589 0.002
atypical teratoid / rhabdoid tumor 1.900 0.001
glioblastoma 2.000 0.001
group 4 medulloblastoma 2.200 0.000
medulloblastoma, large-cell 2.800 0.000
juvenile dermatomyositis 1.085 0.000
acute quadriplegic myopathy 1.297 0.000
sarcoidosis 1.100 0.016
breast carcinoma 1.100 0.006
pediatric high grade glioma 1.100 0.024
primary Sjogren syndrome 1.600 0.007
psoriasis -1.200 0.000
Alzheimer's disease 1.100 0.027
Pick disease 1.500 0.000
invasive ductal carcinoma 1.200 0.015
ulcerative colitis -1.400 0.005
ovarian cancer -1.300 0.001
Gaucher disease type 3 -1.100 0.017

Gene RIF (52)

PMID Text
26735177 Upregulation of GNA13 expression increased the proliferation and tumorigenicity of gastric cancer.
26589794 Knockdown DDR1 reversed the effects of Galpha13 knockdown on cell-cell adhesion and proteolytic invasion in three-dimensional collagen.
26323264 RGS22 acts as a tumor suppressor, repressing human pancreatic adenocarcinoma cell migration by coupling to GNA12/13.
26292217 Galpha13 Switch Region 2 Binds to the Talin Head Domain and Activates alphaIIbbeta3 Integrin in Human Platelets
26100877 Data show that N-linked glycosylation of protease-activated receptor-1 (PAR1) at extracellular loop 2 (ECL2) controls G12/13 versus Gq G-proteins coupling specificity in response to thrombin stimulation.
25889182 GNA13 expression in breast cancer cells is regulated by post-transcriptional mechanisms involving miR-31.
25274307 findings identify a Galpha13-dependent pathway that exerts dual actions in suppressing growth and blocking dissemination of germinal centre B cells that is frequently disrupted in germinal centre B-cell-derived lymphoma
25193986 Our findings highlight the important role of miR-29c in regulating CRC EMT via GSK-3b/b-catenin signaling by targeting GNA13 and PTP4A and provide new insights into the metastatic basis of colorectal cancer
25025568 These results place Blk upstream of the p190RhoGAP-RhoA pathway in Galpha13-activated cells, overall representing an opposing signaling module during CXCL12-triggered invasion.
23699601 Mutation in the Galpha13 gene is associated with diffuse large B-cell lymphoma.
More...

AA Sequence

MADFLPSRSVLSVCFPGCLLTSGEAEQQRKSKEIDKCLSREKTYVKRLVKILLLGAGESGKSTFLKQMRI      1 - 70
IHGQDFDQRAREEFRPTIYSNVIKGMRVLVDAREKLHIPWGDNSNQQHGDKMMSFDTRAPMAAQGMVETR     71 - 140
VFLQYLPAIRALWADSGIQNAYDRRREFQLGESVKYFLDNLDKLGEPDYIPSQQDILLARRPTKGIHEYD    141 - 210
FEIKNVPFKMVDVGGQRSERKRWFECFDSVTSILFLVSSSEFDQVLMEDRLTNRLTESLNIFETIVNNRV    211 - 280
FSNVSIILFLNKTDLLEEKVQIVSIKDYFLEFEGDPHCLRDVQKFLVECFRNKRRDQQQKPLYHHFTTAI    281 - 350
NTENIRLVFRDVKDTILHDNLKQLMLQ                                               351 - 377
//

Text Mined References (102)

PMID Year Title
26735177 2016 GNA13 as a prognostic factor and mediator of gastric cancer progression.
26589794 2016 Cancer Cell Invasion in Three-dimensional Collagen Is Regulated Differentially by G?13 Protein and Discoidin Domain Receptor 1-Par3 Protein Signaling.
26323264 2015 RGS22 inhibits pancreatic adenocarcinoma cell migration through the G12/13 ? subunit/F-actin pathway.
26292217 2015 G?13 Switch Region 2 Binds to the Talin Head Domain and Activates ?IIb?3 Integrin in Human Platelets.
26100877 2015 N-linked glycosylation of protease-activated receptor-1 at extracellular loop 2 regulates G-protein signaling bias.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25889182 2015 MicroRNA-31 controls G protein alpha-13 (GNA13) expression and cell invasion in breast cancer cells.
25274307 2014 Loss of signalling via G?13 in germinal centre B-cell-derived lymphoma.
25193986 2014 MiR-29c mediates epithelial-to-mesenchymal transition in human colorectal carcinoma metastasis via PTP4A and GNA13 regulation of ?-catenin signaling.
25025568 2014 A Blk-p190RhoGAP signaling module downstream of activated G?13 functionally opposes CXCL12-stimulated RhoA activation and cell invasion.
More...