Property Summary

NCBI Gene PubMed Count 34
PubMed Score 79.13
PubTator Score 24.60

Knowledge Summary

Patent (9,208)

Expression

  Differential Expression (13)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 2.600 2.7e-06
Breast cancer 1.300 3.1e-05
ependymoma 1.700 4.3e-06
gastric carcinoma 1.700 3.6e-02
glioblastoma multiforme 1.100 2.6e-12
group 3 medulloblastoma 1.600 1.4e-02
intraductal papillary-mucinous adenoma (... 2.000 4.5e-03
malignant mesothelioma 2.800 3.2e-08
ovarian cancer 1.900 3.3e-05
pediatric high grade glioma 1.100 5.4e-03
primitive neuroectodermal tumor 2.500 2.3e-03
psoriasis 1.200 1.1e-03
tuberculosis 1.900 1.9e-04

Protein-protein Interaction (1)

Gene RIF (18)

AA Sequence

MRPRSALPRLLLPLLLLPAAGPAQFHGEKGISIPDHGFCQPISIPLCTDIAYNQTIMPNLLGHTNQEDAG      1 - 70
LEVHQFYPLVKVQCSPELRFFLCSMYAPVCTVLEQAIPPCRSICERARQGCEALMNKFGFQWPERLRCEH     71 - 140
FPRHGAEQICVGQNHSEDGAPALLTTAPPPGLQPGAGGTPGGPGGGGAPPRYATLEHPFHCPRVLKVPSY    141 - 210
LSYKFLGERDCAAPCEPARPDGSMFFSQEETRFARLWILTWSVLCCASTFFTVTTYLVDMQRFRYPERPI    211 - 280
IFLSGCYTMVSVAYIAGFVLQERVVCNERFSEDGYRTVVQGTKKEGCTILFMMLYFFSMASSIWWVILSL    281 - 350
TWFLAAGMKWGHEAIEANSQYFHLAAWAVPAVKTITILAMGQIDGDLLSGVCFVGLNSLDPLRGFVLAPL    351 - 420
FVYLFIGTSFLLAGFVSLFRIRTIMKHDGTKTEKLERLMVRIGVFSVLYTVPATIVIACYFYEQAFREHW    421 - 490
ERSWVSQHCKSLAIPCPAHYTPRMSPDFTVYMIKYLMTLIVGITSGFWIWSGKTLHSWRKFYTRLTNSRH    491 - 560
GETTV                                                                     561 - 565
//

Text Mined References (34)

PMID Year Title