Property Summary

NCBI Gene PubMed Count 30
Grant Count 55
R01 Count 43
Funding $5,962,687.15
PubMed Score 74.40
PubTator Score 24.60

Knowledge Summary

Patent (9,208)

Expression

Gene RIF (15)

PMID Text
26648389 Sonazoid enhanced sonoporation of the cells with the diagnostic US device and the suppression of proliferation of both HCC cell lines by shRNA-Fz2.
26398330 the present study demonstrated that Fzd2 contributes to the migration and invasion of OSCC cells, at least partly through regulation of the STAT3 pathway
26132195 CD82 enhanced the expression of miR-203 and directly downregulated FZD2 expression, suppressing cancer metastasis/cell migration by inhibiting the Wnt signaling pathway.
25759469 the FRIZZLED2 mutation is a de novo, novel cause for autosomal dominant omodysplasia.
25695658 FZD2 was downregulated in an adenoid cystic carcinoma cell line with high metastatic potential, vs another with low potential. Knockdown of FZD2 downregulated the expression of PAI-1.
25586465 Fz2 was positive in both the cell membrane and cytoplasm of gastric cancer tissues of moderately differentiated and poorly differentiated adenocarcinoma.Fz2 expression pattern in normal stomach tissues.
25417160 Pharmacologic and genetic perturbations reveal that Fzd2 drives epithelial-mesenchymal transition and cell migration through a previously unrecognized, noncanonical pathway that includes Fyn and Stat3.
23748645 It is associated with poor prognosis in glioblastoma patients.
22101459 Data suggest that an anti-Wnt5a antibody was capable of suppressing Wnt5a-dependent internalization of Fz2 receptor, resulting in the prevention of metastasis of gastric cancer cells by inhibiting the activation of Rac1 and the expression of laminin gamma2.
21850537 altered expression of FZD2 might be associated with a proliferative status, thus playing a role in the biology of human medulloblastomas
More...

AA Sequence

MRPRSALPRLLLPLLLLPAAGPAQFHGEKGISIPDHGFCQPISIPLCTDIAYNQTIMPNLLGHTNQEDAG      1 - 70
LEVHQFYPLVKVQCSPELRFFLCSMYAPVCTVLEQAIPPCRSICERARQGCEALMNKFGFQWPERLRCEH     71 - 140
FPRHGAEQICVGQNHSEDGAPALLTTAPPPGLQPGAGGTPGGPGGGGAPPRYATLEHPFHCPRVLKVPSY    141 - 210
LSYKFLGERDCAAPCEPARPDGSMFFSQEETRFARLWILTWSVLCCASTFFTVTTYLVDMQRFRYPERPI    211 - 280
IFLSGCYTMVSVAYIAGFVLQERVVCNERFSEDGYRTVVQGTKKEGCTILFMMLYFFSMASSIWWVILSL    281 - 350
TWFLAAGMKWGHEAIEANSQYFHLAAWAVPAVKTITILAMGQIDGDLLSGVCFVGLNSLDPLRGFVLAPL    351 - 420
FVYLFIGTSFLLAGFVSLFRIRTIMKHDGTKTEKLERLMVRIGVFSVLYTVPATIVIACYFYEQAFREHW    421 - 490
ERSWVSQHCKSLAIPCPAHYTPRMSPDFTVYMIKYLMTLIVGITSGFWIWSGKTLHSWRKFYTRLTNSRH    491 - 560
GETTV                                                                     561 - 565
//

Text Mined References (30)

PMID Year Title
26648389 2016 Suppression of hepatocellular carcinoma cell proliferation by short hairpin RNA of frizzled 2 with Sonazoid-enhanced irradiation.
26398330 2015 Frizzled2 mediates the migration and invasion of human oral squamous cell carcinoma cells through the regulation of the signal transducer and activator of transcription-3 signaling pathway.
26132195 2015 miR-203 Inhibits Frizzled-2 Expression via CD82/KAI1 Expression in Human Lung Carcinoma Cells.
25759469 2015 A mutation in FRIZZLED2 impairs Wnt signaling and causes autosomal dominant omodysplasia.
25695658 2016 FZD2 inhibits the cell growth and migration of salivary adenoid cystic carcinomas.
25586465 2015 Gastric cancer cell proliferation is suppressed by frizzled-2 short hairpin RNA.
25417160 2014 A noncanonical Frizzled2 pathway regulates epithelial-mesenchymal transition and metastasis.
24431302 2014 Wnt signaling in midbrain dopaminergic neuron development and regenerative medicine for Parkinson's disease.
23748645 2014 Immunoreactivity of Wnt5a, Fzd2, Fzd6, and Ryk in glioblastoma: evaluative methodology for DAB chromogenic immunostaining.
22101459 2012 An anti-Wnt5a antibody suppresses metastasis of gastric cancer cells in vivo by inhibiting receptor-mediated endocytosis.
More...