Property Summary

NCBI Gene PubMed Count 12
Grant Count 8
Funding $1,356,434.06
PubMed Score 31.35
PubTator Score 16.14

Knowledge Summary

Patent (2,017)

Expression

  Differential Expression (9)

Disease log2 FC p
malignant mesothelioma 1.300 0.000
cutaneous lupus erythematosus 2.200 0.003
psoriasis -1.900 0.000
osteosarcoma -3.382 0.000
sarcoidosis 1.100 0.012
interstitial cystitis 2.600 0.004
primary Sjogren syndrome 2.700 0.000
ductal carcinoma in situ 1.500 0.042
ulcerative colitis 1.600 0.026

Gene RIF (5)

PMID Text
26195725 A novel RvD2-GPR18 resolution axis stimulates human and mouse phagocyte functions to control bacterial infections and promote organ protection.
24762058 the results presented herein provide further evidence for GPR18 as a candidate cannabinoid receptor
21261596 REVIEW: functional properties and in vivo biology
20880198 GPR18, the most abundantly overexpressed orphan G-protein-coupled receptor in all melanoma metastases, is constitutively active and inhibits apoptosis, indicating an important role for GPR18 in tumor cell survival.
16844083 N-arachidonylglycine is a natural ligand for GPR18

AA Sequence

MITLNNQDQPVPFNSSHPDEYKIAALVFYSCIFIIGLFVNITALWVFSCTTKKRTTVTIYMMNVALVDLI      1 - 70
FIMTLPFRMFYYAKDEWPFGEYFCQILGALTVFYPSIALWLLAFISADRYMAIVQPKYAKELKNTCKAVL     71 - 140
ACVGVWIMTLTTTTPLLLLYKDPDKDSTPATCLKISDIIYLKAVNVLNLTRLTFFFLIPLFIMIGCYLVI    141 - 210
IHNLLHGRTSKLKPKVKEKSIRIIITLLVQVLVCFMPFHICFAFLMLGTGENSYNPWGAFTTFLMNLSTC    211 - 280
LDVILYYIVSKQFQARVISVMLYRNYLRSMRRKSFRSGSLRSLSNINSEML                       281 - 331
//

Text Mined References (12)

PMID Year Title
26195725 2015 Identification of resolvin D2 receptor mediating resolution of infections and organ protection.
24762058 2014 Activation of GPR18 by cannabinoid compounds: a tale of biased agonism.
23128233 2012 Host-microbe interactions have shaped the genetic architecture of inflammatory bowel disease.
21261596 2011 EBI2, GPR18 and GPR17--three structurally related, but biologically distinct 7TM receptors.
20880198 2011 Quantitative expression profiling of G-protein-coupled receptors (GPCRs) in metastatic melanoma: the constitutively active orphan GPCR GPR18 as novel drug target.
18577758 2008 Dissociation of heterotrimeric g proteins in cells.
16844083 2006 Identification of N-arachidonylglycine as the endogenous ligand for orphan G-protein-coupled receptor GPR18.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15057823 2004 The DNA sequence and analysis of human chromosome 13.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
More...