Property Summary

NCBI Gene PubMed Count 19
PubMed Score 4.85
PubTator Score 5.04

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (8)

Disease log2 FC p
acute quadriplegic myopathy 1.020 5.1e-07
diabetes mellitus -1.200 1.1e-03
glioblastoma 1.100 7.0e-03
lung cancer 1.100 1.8e-02
Multiple myeloma 1.416 9.9e-04
ovarian cancer 2.300 3.7e-08
pancreatic ductal adenocarcinoma liver m... 1.155 7.2e-03
psoriasis 1.800 2.6e-05

Synonym

Accession Q14320 A8KAQ4 B2R997 Q5HY37 Q6PJH5
Symbols 9F
XAP5
HXC26
HXC-26
DXS9928E

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (2)

AA Sequence

MAQYKGAASEAGRAMHLMKKREKQREQMEQMKQRIAEENIMKSNIDKKFSAHYDAVEAELKSSTVGLVTL      1 - 70
NDMKAKQEALVKEREKQLAKKEQSKELQMKLEKLREKERKKEAKRKISSLSFTLEEEEEGGEEEEEAAMY     71 - 140
EEEMEREEITTKKRKLGKNPDVDTSFLPDRDREEEENRLREELRQEWEAKQEKIKSEEIEITFSYWDGSG    141 - 210
HRRTVKMRKGNTMQQFLQKALEILRKDFSELRSAGVEQLMYIKEDLIIPHHHSFYDFIVTKARGKSGPLF    211 - 280
NFDVHDDVRLLSDATVEKDESHAGKVVLRSWYEKNKHIFPASRWEPYDPEKKWDKYTIR               281 - 339
//

Text Mined References (23)

PMID Year Title