Property Summary

NCBI Gene PubMed Count 19
PubMed Score 4.44
PubTator Score 5.04

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
ovarian cancer 8492 3.72349101458229E-8
acute quadriplegic myopathy 1157 5.14440814902756E-7
psoriasis 6685 2.63445688101397E-5
Multiple myeloma 1328 9.92299665404472E-4
diabetes mellitus 1663 0.00110061128536873
glioblastoma 5572 0.00702118111372806
pancreatic ductal adenocarcinoma liver metastasis 1795 0.00717454335133454
lung cancer 4473 0.0176518522348746
Disease Target Count Z-score Confidence
Invasive lobular carcinoma 6 3.175 1.6

Expression

  Differential Expression (8)

Disease log2 FC p
Multiple myeloma 1.416 0.001
psoriasis 1.800 0.000
glioblastoma 1.100 0.007
acute quadriplegic myopathy 1.020 0.000
pancreatic ductal adenocarcinoma liver m... 1.155 0.007
lung cancer 1.100 0.018
diabetes mellitus -1.200 0.001
ovarian cancer 2.300 0.000

Synonym

Accession Q14320 A8KAQ4 B2R997 Q5HY37 Q6PJH5
Symbols 9F
XAP5
HXC26
HXC-26
DXS9928E

Gene

  Ortholog (9)

Species Source
Chimp OMA EggNOG
Mouse OMA Inparanoid
Rat OMA Inparanoid
Dog OMA Inparanoid
Horse OMA Inparanoid
Cow OMA Inparanoid
Anole lizard OMA Inparanoid
Xenopus OMA Inparanoid
Zebrafish OMA Inparanoid

Gene RIF (2)

PMID Text
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MAQYKGAASEAGRAMHLMKKREKQREQMEQMKQRIAEENIMKSNIDKKFSAHYDAVEAELKSSTVGLVTL      1 - 70
NDMKAKQEALVKEREKQLAKKEQSKELQMKLEKLREKERKKEAKRKISSLSFTLEEEEEGGEEEEEAAMY     71 - 140
EEEMEREEITTKKRKLGKNPDVDTSFLPDRDREEEENRLREELRQEWEAKQEKIKSEEIEITFSYWDGSG    141 - 210
HRRTVKMRKGNTMQQFLQKALEILRKDFSELRSAGVEQLMYIKEDLIIPHHHSFYDFIVTKARGKSGPLF    211 - 280
NFDVHDDVRLLSDATVEKDESHAGKVVLRSWYEKNKHIFPASRWEPYDPEKKWDKYTIR               281 - 339
//

Text Mined References (22)

PMID Year Title
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
21269460 2011 Initial characterization of the human central proteome.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16381901 2006 The LIFEdb database in 2006.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15772651 2005 The DNA sequence of the human X chromosome.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
More...