Property Summary

NCBI Gene PubMed Count 56
PubMed Score 49.54
PubTator Score 44.24

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
osteosarcoma 7950 9.7e-05
psoriasis 6694 4.5e-04
Rheumatoid arthritis 1191 1.1e-02
non primary Sjogren syndrome sicca 891 1.8e-02
group 3 medulloblastoma 4104 2.4e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8
Disease Target Count Z-score Confidence
spina bifida 1074 3.476 1.7

Expression

  Differential Expression (5)

Disease log2 FC p
group 3 medulloblastoma -1.100 2.4e-02
non primary Sjogren syndrome sicca 1.100 1.8e-02
osteosarcoma -2.320 9.7e-05
psoriasis -1.800 4.5e-04
Rheumatoid arthritis -1.600 1.1e-02

Gene RIF (28)

AA Sequence

MASCAEPSEPSAPLPAGVPPLEDFEVLDGVEDAEGEEEEEEEEEEEDDLSELPPLEDMGQPPAEEAEQPG      1 - 70
ALAREFLAAMEPEPAPAPAPEEWLDILGNGLLRKKTLVPGPPGSSRPVKGQVVTVHLQTSLENGTRVQEE     71 - 140
PELVFTLGDCDVIQALDLSVPLMDVGETAMVTADSKYCYGPQGRSPYIPPHAALCLEVTLKTAVDGPDLE    141 - 210
MLTGQERVALANRKRECGNAHYQRADFVLAANSYDLAIKAITSSAKVDMTFEEEAQLLQLKVKCLNNLAA    211 - 280
SQLKLDHYRAALRSCSLVLEHQPDNIKALFRKGKVLAQQGEYSEAIPILRAALKLEPSNKTIHAELSKLV    281 - 350
KKHAAQRSTETALYRKMLGNPSRLPAKCPGKGAWSIPWKWLFGATAVALGGVALSVVIAARN            351 - 412
//

Text Mined References (61)

PMID Year Title