Property Summary

NCBI Gene PubMed Count 54
Grant Count 11
R01 Count 7
Funding $436,103.94
PubMed Score 46.60
PubTator Score 44.24

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
Rheumatoid Arthritis -1.600 0.011
psoriasis -2.400 0.000
osteosarcoma -2.320 0.000
group 3 medulloblastoma -1.500 0.010
non primary Sjogren syndrome sicca 1.100 0.018

Gene RIF (27)

PMID Text
24295050 Overexpression of permanently active S100P in Huh-7 cells inhibited the interaction of FKBP38 with Bcl-2, resulting in the suppression of Bcl-2 stability
24145868 The information presented here provides important clues for understanding the catalytic activity of FKBP38, its regulation by the unique N-terminal extension, and the potential calcium- and calmodulin-mediated activation of FKBP38.
22523079 The derived structure model of the complex between Bcl-2 and the FKBP38 catalytic domain features both electrostatic and hydrophobic intermolecular contacts and provides a rationale for the regulation of the FKBP38/Bcl-2 interaction by Ca(2+).
22474283 FK506 binding protein 8 peptidylprolyl isomerase activity manages a late stage of cystic fibrosis transmembrane conductance regulator (CFTR) folding and stability
22030396 Data support a dual role for FKBP38 in regulating CFTR synthesis and post-translational folding.
21737445 a dual mechanism for PA activation of mTORC1: PA displaces FKBP38 from mTOR and allosterically stimulates the catalytic activity of mTORC1.
21320469 These results demonstrate that FKBP38 is a novel regulator of the oncogenic protein PRL-3 abundance and that alteration in the stability of PRL-3 can have a dramatic impact on cell proliferation.
20877624 Observational study of gene-disease association. (HuGE Navigator)
20707607 novel insights into the structural arrangement of FKBP38/calmodulin complex
20140889 this charge-sensitive site in the FKBP domain participates in the regulation of FKBP38 function by enabling electrostatic interactions with ligand proteins and/or salt ions such as Ca(2+)
More...

AA Sequence

MASCAEPSEPSAPLPAGVPPLEDFEVLDGVEDAEGEEEEEEEEEEEDDLSELPPLEDMGQPPAEEAEQPG      1 - 70
ALAREFLAAMEPEPAPAPAPEEWLDILGNGLLRKKTLVPGPPGSSRPVKGQVVTVHLQTSLENGTRVQEE     71 - 140
PELVFTLGDCDVIQALDLSVPLMDVGETAMVTADSKYCYGPQGRSPYIPPHAALCLEVTLKTAVDGPDLE    141 - 210
MLTGQERVALANRKRECGNAHYQRADFVLAANSYDLAIKAITSSAKVDMTFEEEAQLLQLKVKCLNNLAA    211 - 280
SQLKLDHYRAALRSCSLVLEHQPDNIKALFRKGKVLAQQGEYSEAIPILRAALKLEPSNKTIHAELSKLV    281 - 350
KKHAAQRSTETALYRKMLGNPSRLPAKCPGKGAWSIPWKWLFGATAVALGGVALSVVIAARN            351 - 412
//

Text Mined References (59)

PMID Year Title
26567527 2015 Involvement of FKBP6 in hepatitis C virus replication.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25621951 2015 USP30 and parkin homeostatically regulate atypical ubiquitin chains on mitochondria.
24295050 2014 Ca2+/S100 proteins inhibit the interaction of FKBP38 with Bcl-2 and Hsp90.
24169621 2014 Elucidating novel hepatitis C virus-host interactions using combined mass spectrometry and functional genomics approaches.
24145868 2013 Functional role of the flexible N-terminal extension of FKBP38 in catalysis.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22523079 2012 The FKBP38 catalytic domain binds to Bcl-2 via a charge-sensitive loop.
22474283 2012 FK506 binding protein 8 peptidylprolyl isomerase activity manages a late stage of cystic fibrosis transmembrane conductance regulator (CFTR) folding and stability.
22030396 2011 FKBP38 peptidylprolyl isomerase promotes the folding of cystic fibrosis transmembrane conductance regulator in the endoplasmic reticulum.
More...