Property Summary

NCBI Gene PubMed Count 36
PubMed Score 108.25
PubTator Score 45.74

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Hepatitis 67 4.207 2.1
Alveolar echinococcosis 7 3.206 1.6
Hepatitis B 108 3.005 1.5

Expression

  Differential Expression (33)

Disease log2 FC p
adrenocortical carcinoma -1.898 1.4e-03
Astrocytoma, Pilocytic 1.100 4.2e-03
Atopic dermatitis -1.200 2.0e-02
atypical teratoid / rhabdoid tumor -1.300 1.9e-02
autosomal dominant Emery-Dreifuss muscul... 1.082 2.8e-02
Breast cancer -1.300 3.0e-04
chronic lymphosyte leukemia -1.500 1.1e-06
colon cancer -2.500 5.7e-03
dermatomyositis 1.700 7.8e-03
diabetes mellitus -1.200 1.6e-02
Duchenne muscular dystrophy 1.555 3.3e-06
fibroadenoma -1.200 2.2e-02
group 3 medulloblastoma -1.200 4.9e-02
head and neck cancer -1.300 1.9e-02
interstitial cystitis 1.200 3.5e-03
intraductal papillary-mucinous carcinoma... -2.300 1.8e-02
juvenile dermatomyositis 1.677 1.1e-08
limb girdle muscular dystrophy 2A 1.063 1.5e-02
lung adenocarcinoma -1.100 4.2e-05
lung cancer 1.800 1.5e-03
lung carcinoma -2.000 2.4e-14
medulloblastoma, large-cell -2.300 7.0e-05
mucosa-associated lymphoid tissue lympho... 2.550 2.8e-02
nephrosclerosis 1.071 1.5e-03
non-small cell lung cancer -1.096 9.7e-08
ovarian cancer -3.100 1.7e-05
pancreatic ductal adenocarcinoma liver m... -1.415 2.6e-02
primary Sjogren syndrome 1.500 3.2e-04
psoriasis -1.200 1.3e-03
sarcoidosis 2.500 1.2e-02
subependymal giant cell astrocytoma 2.503 4.5e-02
tuberculosis 3.000 1.4e-07
Waldenstrons macroglobulinemia 1.490 4.0e-02

Synonym

Accession Q14314
Symbols T49
pT49

Gene

PANTHER Protein Class (1)

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (25)

AA Sequence

MKLANWYWLSSAVLATYGFLVVANNETEEIKDERAKDVCPVRLESRGKCEEAGECPYQVSLPPLTIQLPK      1 - 70
QFSRIEEVFKEVQNLKEIVNSLKKSCQDCKLQADDNGDPGRNGLLLPSTGAPGEVGDNRVRELESEVNKL     71 - 140
SSELKNAKEEINVLHGRLEKLNLVNMNNIENYVDSKVANLTFVVNSLDGKCSKCPSQEQIQSRPVQHLIY    141 - 210
KDCSDYYAIGKRSSETYRVTPDPKNSSFEVYCDMETMGGGWTVLQARLDGSTNFTRTWQDYKAGFGNLRR    211 - 280
EFWLGNDKIHLLTKSKEMILRIDLEDFNGVELYALYDQFYVANEFLKYRLHVGNYNGTAGDALRFNKHYN    281 - 350
HDLKFFTTPDKDNDRYPSGNCGLYYSSGWWFDACLSANLNGKYYHQKYRGVRNGIFWGTWPGVSEAHPGG    351 - 420
YKSSFKEAKMMIRPKHFKP                                                       421 - 439
//

Text Mined References (37)

PMID Year Title