Property Summary

NCBI Gene PubMed Count 34
Grant Count 17
R01 Count 11
Funding $1,523,327.37
PubMed Score 99.13
PubTator Score 45.74

Knowledge Summary

Patent

No data available

Expression

Gene RIF (23)

PMID Text
25971300 Results show that FGL2 functions as a key immune-suppressive modulator and has potential as an immunotherapeutic target for treating glioblastoma multiforme (GBM).
25496996 these results suggest that FGL-2 mediates angiogenesis and tumorigenesis not by thrombin-mediated mechanism but rather through FGF-2/ERK signaling pathway.
25303152 FGL-2 prothrombinase activity in PBMC of lymphoma patients is increased in active disease and normalizes during remission, thus being a potential marker for follow up of lymphoma patients.
25129313 Studied fibrinogen-like protein 2 expression and its role in CRC metastasis and underlying molecular mechanisms; results suggest that FGL2 plays an important oncogenic role in CRC aggressiveness by inducing EMT.
24728278 The selected peptide sequence NPG-12 may be a critical domain for hfgl2 prothrombinase activity.
24287641 immunomodulatory activity of FGL2 may be involved in the immunopathogenesis of inflammatory bowel disease
23898208 HIV-1 Vif downregulates the expression of fibrinogen-like 2 (FGL2) in Vif-expression T cells
23383108 HIV-1 Vif downregulates the expression of fibrinogen-like 2 (FGL2) in Vif-expression T cells
23333304 HIV-1 Vif downregulates the expression of fibrinogen-like 2 (FGL2) in Vif-expression T cells
23195010 Serum fgl2 levels were increased among renal allograft recipients with acute rejection episodes to an extent dependent upon the pathological type and severity of the response.
More...

AA Sequence

MKLANWYWLSSAVLATYGFLVVANNETEEIKDERAKDVCPVRLESRGKCEEAGECPYQVSLPPLTIQLPK      1 - 70
QFSRIEEVFKEVQNLKEIVNSLKKSCQDCKLQADDNGDPGRNGLLLPSTGAPGEVGDNRVRELESEVNKL     71 - 140
SSELKNAKEEINVLHGRLEKLNLVNMNNIENYVDSKVANLTFVVNSLDGKCSKCPSQEQIQSRPVQHLIY    141 - 210
KDCSDYYAIGKRSSETYRVTPDPKNSSFEVYCDMETMGGGWTVLQARLDGSTNFTRTWQDYKAGFGNLRR    211 - 280
EFWLGNDKIHLLTKSKEMILRIDLEDFNGVELYALYDQFYVANEFLKYRLHVGNYNGTAGDALRFNKHYN    281 - 350
HDLKFFTTPDKDNDRYPSGNCGLYYSSGWWFDACLSANLNGKYYHQKYRGVRNGIFWGTWPGVSEAHPGG    351 - 420
YKSSFKEAKMMIRPKHFKP                                                       421 - 439
//

Text Mined References (35)

PMID Year Title
25971300 2015 FGL2 as a Multimodality Regulator of Tumor-Mediated Immune Suppression and Therapeutic Target in Gliomas.
25496996 2015 The cell-membrane prothrombinase, fibrinogen-like protein 2, promotes angiogenesis and tumor development.
25303152 2014 Increased activity of cell membrane-associated prothrombinase, fibrinogen-like protein 2, in peripheral blood mononuclear cells of B-cell lymphoma patients.
25129313 2014 Overexpression of fibrinogen-like protein 2 induces epithelial-to-mesenchymal transition and promotes tumor progression in colorectal carcinoma.
24728278 2014 Novel antibody against a glutamic acid-rich human fibrinogen-like protein 2-derived peptide near Ser91 inhibits hfgl2 prothrombinase activity.
24287641 2014 Intestinal and peripheral fibrinogen-like protein 2 expression in inflammatory bowel disease.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23195010 2012 Serum level of soluble fibrinogen-like protein 2 in renal allograft recipients with acute rejection: a preliminary study.
22983266 2013 Increased circulating fibrinogen-like protein 2 in patients with systemic sclerosis.
More...