Property Summary

Ligand Count 24
NCBI Gene PubMed Count 248
PubMed Score 538.83
PubTator Score 792.31

Knowledge Summary

Patent (41,373)

Expression

  Differential Expression (14)

Disease log2 FC p
adult high grade glioma -1.500 4.4e-04
astrocytoma -1.100 4.8e-16
Astrocytoma, Pilocytic -1.600 4.0e-06
atypical teratoid / rhabdoid tumor -2.000 1.1e-09
ependymoma -1.400 5.2e-10
glioblastoma -1.400 2.4e-06
group 3 medulloblastoma -1.600 2.4e-03
lung carcinoma 1.100 1.1e-16
medulloblastoma, large-cell -2.400 6.2e-07
oligodendroglioma -1.200 4.8e-15
osteosarcoma -2.402 1.9e-06
Pick disease -1.400 1.0e-02
primitive neuroectodermal tumor -1.800 1.0e-05
subependymal giant cell astrocytoma -1.868 1.3e-02

Protein-protein Interaction (1)

Gene RIF (176)

AA Sequence

MSGVSEPLSRVKLGTLRRPEGPAEPMVVVPVDVEKEDVRILKVCFYSNSFNPGKNFKLVKCTVQTEIREI      1 - 70
ITSILLSGRIGPNIRLAECYGLRLKHMKSDEIHWLHPQMTVGEVQDKYECLHVEAEWRYDLQIRYLPEDF     71 - 140
MESLKEDRTTLLYFYQQLRNDYMQRYASKVSEGMALQLGCLELRRFFKDMPHNALDKKSNFELLEKEVGL    141 - 210
DLFFPKQMQENLKPKQFRKMIQQTFQQYASLREEECVMKFFNTLAGFANIDQETYRCELIQGWNITVDLV    211 - 280
IGPKGIRQLTSQDAKPTCLAEFKQIRSIRCLPLEEGQAVLQLGIEGAPQALSIKTSSLAEAENMADLIDG    281 - 350
YCRLQGEHQGSLIIHPRKDGEKRNSLPQIPMLNLEARRSHLSESCSIESDIYAEIPDETLRRPGGPQYGI    351 - 420
AREDVVLNRILGEGFFGEVYEGVYTNHKGEKINVAVKTCKKDCTLDNKEKFMSEAVIMKNLDHPHIVKLI    421 - 490
GIIEEEPTWIIMELYPYGELGHYLERNKNSLKVLTLVLYSLQICKAMAYLESINCVHRDIAVRNILVASP    491 - 560
ECVKLGDFGLSRYIEDEDYYKASVTRLPIKWMSPESINFRRFTTASDVWMFAVCMWEILSFGKQPFFWLE    561 - 630
NKDVIGVLEKGDRLPKPDLCPPVLYTLMTRCWDYDPSDRPRFTELVCSLSDVYQMEKDIAMEQERNARYR    631 - 700
TPKILEPTAFQEPPPKPSRPKYRPPPQTNLLAPKLQFQVPEGLCASSPTLTSPMEYPSPVNSLHTPPLHR    701 - 770
HNVFKRHSMREEDFIQPSSREEAQQLWEAEKVKMRQILDKQQKQMVEDYQWLRQEEKSLDPMVYMNDKSP    771 - 840
LTPEKEVGYLEFTGPPQKPPRLGAQSIQPTANLDRTDDLVYLNVMELVRAVLELKNELCQLPPEGYVVVV    841 - 910
KNVGLTLRKLIGSVDDLLPSLPSSSRTEIEGTQKLLNKDLAELINKMRLAQQNAVTSLSEECKRQMLTAS    911 - 980
HTLAVDAKNLLDAVDQAKVLANLAHPPAE                                             981 - 1009
//

Text Mined References (267)

PMID Year Title