Property Summary

NCBI Gene PubMed Count 240
Grant Count 381
R01 Count 307
Funding $28,773,530.81
PubMed Score 516.10
PubTator Score 792.31

Knowledge Summary

Patent (41,373)

Expression

  Differential Expression (14)

Disease log2 FC p
astrocytoma -1.100 0.000
oligodendroglioma -1.200 0.000
osteosarcoma -2.402 0.000
ependymoma -1.400 0.000
glioblastoma -1.400 0.000
group 4 medulloblastoma -2.000 0.000
atypical teratoid/rhabdoid tumor -2.100 0.000
medulloblastoma, large-cell -2.400 0.000
primitive neuroectodermal tumor -1.800 0.000
adult high grade glioma -1.500 0.000
pilocytic astrocytoma -1.600 0.000
subependymal giant cell astrocytoma -1.868 0.013
lung carcinoma 1.100 0.000
Pick disease -1.400 0.010

Synonym

Accession Q14289 D3DST0 Q13475 Q14290 Q16709 Q6PID4
Symbols PKB
PTK
CAKB
FAK2
PYK2
CADTK
FADK2
RAFTK

Gene

PDB

3GM1   3U3F   4R32   2FO6   2LK4   3CC6   3ET7   3FZO   3FZP   3FZR   3FZS   3FZT   3GM2   3GM3   3H3C   4EKU   4H1J   4H1M   4XEF   4XEK   4XEV  

  TechDev Info (1)

Gary Johnson Kinome profile via MIB/MS Technology

MLP Assay (2)

AID Type Active / Inconclusive / Inactive Description
1641 confirmatory 93 / 0 / 118 TR-FRET counterscreen for FAK inhibitors: dose-response biochemical high throughput screening assay to identify inhibitors of Proline-rich tyrosine kinase 2 (Pyk2)
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448

Gene RIF (175)

PMID Text
26866924 Src has a role in priming Pyk2 (but not FAK) phosphorylation and subsequent activation downstream of integrins
26866573 Pyk2-focal adhesion targeting domain interacts with and binds to leupaxin.
26352169 Pyk2 is a key downstream signaling molecules of CCR7 in SCCHN, which promotes SCCHN tumorigenesis and progression.
26330541 Phosphoproteomic analysis identifies FAK2 as a potential therapeutic target for tamoxifen resistance in breast cancer.
26274564 FAK and PYK2 functioned redundantly to promote the Wnt/beta-catenin pathway by phosphorylating GSK3beta(Y216) to reinforce pathway output-beta-catenin accumulation and intestinal tumorigenesis.
26202465 Data strongly suggest that chemokine-stimulated associations between Vav1, SLP-76, and ADAP facilitate Rac1 activation and alpha4beta1-mediated adhesion, whereas Pyk2 opposes this adhesion by limiting Rac1 activation.
26109718 This study identified Pyk2 as a cellular component required for the intracellular trafficking of HPV16 during infection.
26084289 Studies suggest that PYK2 is a common downstream effector of ErbB and IL8 receptors, and that PYK2 integrates their signaling pathways through a positive feedback loop to potentiate breast cancer invasion.
25967238 Fyn, but not Lyn, was required for complete Pyk2 phosphorylation by thrombin.
25889845 These results suggest that melatonin exerts anti-migratory and anti-invasive effects on glioma cells in response to hypoxia via reactive oxygen species-alphavbeta3 integrin-FAK/Pyk2 signaling pathways.
More...

AA Sequence

MSGVSEPLSRVKLGTLRRPEGPAEPMVVVPVDVEKEDVRILKVCFYSNSFNPGKNFKLVKCTVQTEIREI      1 - 70
ITSILLSGRIGPNIRLAECYGLRLKHMKSDEIHWLHPQMTVGEVQDKYECLHVEAEWRYDLQIRYLPEDF     71 - 140
MESLKEDRTTLLYFYQQLRNDYMQRYASKVSEGMALQLGCLELRRFFKDMPHNALDKKSNFELLEKEVGL    141 - 210
DLFFPKQMQENLKPKQFRKMIQQTFQQYASLREEECVMKFFNTLAGFANIDQETYRCELIQGWNITVDLV    211 - 280
IGPKGIRQLTSQDAKPTCLAEFKQIRSIRCLPLEEGQAVLQLGIEGAPQALSIKTSSLAEAENMADLIDG    281 - 350
YCRLQGEHQGSLIIHPRKDGEKRNSLPQIPMLNLEARRSHLSESCSIESDIYAEIPDETLRRPGGPQYGI    351 - 420
AREDVVLNRILGEGFFGEVYEGVYTNHKGEKINVAVKTCKKDCTLDNKEKFMSEAVIMKNLDHPHIVKLI    421 - 490
GIIEEEPTWIIMELYPYGELGHYLERNKNSLKVLTLVLYSLQICKAMAYLESINCVHRDIAVRNILVASP    491 - 560
ECVKLGDFGLSRYIEDEDYYKASVTRLPIKWMSPESINFRRFTTASDVWMFAVCMWEILSFGKQPFFWLE    561 - 630
NKDVIGVLEKGDRLPKPDLCPPVLYTLMTRCWDYDPSDRPRFTELVCSLSDVYQMEKDIAMEQERNARYR    631 - 700
TPKILEPTAFQEPPPKPSRPKYRPPPQTNLLAPKLQFQVPEGLCASSPTLTSPMEYPSPVNSLHTPPLHR    701 - 770
HNVFKRHSMREEDFIQPSSREEAQQLWEAEKVKMRQILDKQQKQMVEDYQWLRQEEKSLDPMVYMNDKSP    771 - 840
LTPEKEVGYLEFTGPPQKPPRLGAQSIQPTANLDRTDDLVYLNVMELVRAVLELKNELCQLPPEGYVVVV    841 - 910
KNVGLTLRKLIGSVDDLLPSLPSSSRTEIEGTQKLLNKDLAELINKMRLAQQNAVTSLSEECKRQMLTAS    911 - 980
HTLAVDAKNLLDAVDQAKVLANLAHPPAE                                             981 - 1009
//

Text Mined References (260)

PMID Year Title
26866924 2016 Novel Role of Src in Priming Pyk2 Phosphorylation.
26866573 2016 Structural Basis for the Interaction between Pyk2-FAT Domain and Leupaxin LD Repeats.
26352169 2015 The role of Pyk2 in the CCR7-mediated regulation of metastasis and viability in squamous cell carcinoma of the head and neck cells in vivo and in vitro.
26330541 2015 Phosphoproteomic Analysis Identifies Focal Adhesion Kinase 2 (FAK2) as a Potential Therapeutic Target for Tamoxifen Resistance in Breast Cancer.
26274564 2015 FAK/PYK2 promotes the Wnt/?-catenin pathway and intestinal tumorigenesis by phosphorylating GSK3?.
26202465 2015 Positive and negative regulation by SLP-76/ADAP and Pyk2 of chemokine-stimulated T-lymphocyte adhesion mediated by integrin ?4?1.
26109718 2015 A Dual Role for the Nonreceptor Tyrosine Kinase Pyk2 during the Intracellular Trafficking of Human Papillomavirus 16.
26084289 2015 PYK2 integrates growth factor and cytokine receptors signaling and potentiates breast cancer invasion via a positive feedback loop.
25967238 2015 The focal adhesion kinase Pyk2 links Ca2+ signalling to Src family kinase activation and protein tyrosine phosphorylation in thrombin-stimulated platelets.
25889845 2015 Involvement of ROS-alpha v beta 3 integrin-FAK/Pyk2 in the inhibitory effect of melatonin on U251 glioma cell migration and invasion under hypoxia.
More...