Property Summary

NCBI Gene PubMed Count 33
Grant Count 24
Funding $16,878,787.27
PubMed Score 62.56
PubTator Score 20.50

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
spina bifida -2.598 0.032
acute myeloid leukemia 1.200 0.047

Gene RIF (2)

PMID Text
25016529 Letter: report elevated ERV3-1 levels in colorectal neoplasms.
15081124 molecular evolution and comparison with other primates

AA Sequence

MLGMNMLLITLFLLLPLSMLKGEPWEGCLHCTHTTWSGNIMTKTLLYHTYYECAGTCLGTCTHNQTTYSV      1 - 70
CDPGRGQPYVCYDPKSSPGTWFEIHVGSKEGDLLNQTKVFPSGKDVVSLYFDVCQIVSMGSLFPVIFSSM     71 - 140
EYYSSCHKNRYAHPACSTDSPVTTCWDCTTWSTNQQSLGPIMLTKIPLEPDCKTSTCNSVNLTILEPDQP    141 - 210
IWTTGLKAPLGARVSGEEIGPGAYVYLYIIKKTRTRSTQQFRVFESFYEHVNQKLPEPPPLASNLFAQLA    211 - 280
ENIASSLHVASCYVCGGMNMGDQWPWEARELMPQDNFTLTASSLEPAPSSQSIWFLKTSIIGKFCIARWG    281 - 350
KAFTDPVGELTCLGQQYYNETLGKTLWRGKSNNSESPHPSPFSRFPSLNHSWYQLEAPNTWQAPSGLYWI    351 - 420
CGPQAYRQLPAKWSGACVLGTIRPSFFLMPLKQGEALGYPIYDETKRKSKRGITIGDWKDNEWPPERIIQ    421 - 490
YYGPATWAEDGMWGYRTPVYMLNRIIRLQAVLEIITNETAGALNLLAQQATKMRNVIYQNRLALDYLLAQ    491 - 560
EEGVCGKFNLTNCCLELDDEGKVIKEITAKIQKLAHIPVQTWKG                              561 - 604
//

Text Mined References (33)

PMID Year Title
27486264 2016 The role of syncytins in human reproduction and reproductive organ cancers.
25016529 2014 Elevation of human ERV3-1 env protein expression in colorectal cancer.
24043713 2014 Human ERV3-1 env protein expression in various human tissues and tumours.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
21542922 2011 A revised nomenclature for transcribed human endogenous retroviral loci.
19540319 2009 Classification and nomenclature of endogenous retroviral sequences (ERVs): problems and recommendations.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15994821 2005 ERV3 and related sequences in humans: structure and RNA expression.
15081124 2004 Conservation and loss of the ERV3 open reading frame in primates.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
More...