Property Summary

NCBI Gene PubMed Count 35
PubMed Score 62.85
PubTator Score 20.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
spina bifida 1074 3.2e-02
acute myeloid leukemia 783 4.7e-02
Disease Target Count Z-score Confidence
Choriocarcinoma 14 4.107 2.1
Gestational trophoblastic neoplasm 17 3.44 1.7

Expression

  Differential Expression (2)

Disease log2 FC p
acute myeloid leukemia 1.200 4.7e-02
spina bifida -2.598 3.2e-02

Gene RIF (3)

AA Sequence

MLGMNMLLITLFLLLPLSMLKGEPWEGCLHCTHTTWSGNIMTKTLLYHTYYECAGTCLGTCTHNQTTYSV      1 - 70
CDPGRGQPYVCYDPKSSPGTWFEIHVGSKEGDLLNQTKVFPSGKDVVSLYFDVCQIVSMGSLFPVIFSSM     71 - 140
EYYSSCHKNRYAHPACSTDSPVTTCWDCTTWSTNQQSLGPIMLTKIPLEPDCKTSTCNSVNLTILEPDQP    141 - 210
IWTTGLKAPLGARVSGEEIGPGAYVYLYIIKKTRTRSTQQFRVFESFYEHVNQKLPEPPPLASNLFAQLA    211 - 280
ENIASSLHVASCYVCGGMNMGDQWPWEARELMPQDNFTLTASSLEPAPSSQSIWFLKTSIIGKFCIARWG    281 - 350
KAFTDPVGELTCLGQQYYNETLGKTLWRGKSNNSESPHPSPFSRFPSLNHSWYQLEAPNTWQAPSGLYWI    351 - 420
CGPQAYRQLPAKWSGACVLGTIRPSFFLMPLKQGEALGYPIYDETKRKSKRGITIGDWKDNEWPPERIIQ    421 - 490
YYGPATWAEDGMWGYRTPVYMLNRIIRLQAVLEIITNETAGALNLLAQQATKMRNVIYQNRLALDYLLAQ    491 - 560
EEGVCGKFNLTNCCLELDDEGKVIKEITAKIQKLAHIPVQTWKG                              561 - 604
//

Text Mined References (35)

PMID Year Title