Property Summary

NCBI Gene PubMed Count 49
Grant Count 38
R01 Count 7
Funding $3,493,238.29
PubMed Score 213.62
PubTator Score 56.43

Knowledge Summary

Patent

No data available

Expression

Gene RIF (27)

PMID Text
26299329 TRIM25 plays an additional role in RIG-I/MDA5 signaling other than RIG-I ubiquitination via activation of NF-kappaB.
26138103 The PR-2B DENV-2 produced increased levels of subgenomic flavivirus RNA (sfRNA) relative to genomic RNA during replication. PR-2B sfRNA showed sequence dependent binding to and prevention of tripartite motif 25 (TRIM25) deubiquitylation, which is critical for sustained and amplified retinoic acid-inducible gene 1 (RIG-I)-induced type I interferon expression.
25728675 Data show that TRIM25 enhances p53 and Mdm2 abundance by preventing their proteasomal degradation. At the same time, TRIM25 inhibits p53's transcriptional activity and dampens the response to DNA damage.
25457611 Trim25 binds to the conserved terminal loop (CTL) of pre-let-7 and activates TuT4, allowing for more efficient Lin28a-mediated uridylation.
24810856 Our data uncovers a previously unknown functional link between gp78 and TRIM25 and provides mechanistic insight into gp78-mediated protein ubiquitylation.
24399297 Data indicate ubiquitin-specific protease 15 (USP15) as a critical regulator of the tripartite motif protein 25 (TRIM25)- and RNA sensor retinoic acid-inducible gene-I (RIG-I)-mediated antiviral immune response
24131985 In controls, RNF125 is the highest expressed gene, whereas in HIV infection progressors, RIG-I is either the highest expressed gene or is expressed similarly to RNF125 and TRIM25.
22626058 Study reports that RLR activation triggers MAVS ubiquitination on lysine 7 and 10 by the E3 ubiquitin ligase TRIM25 and marks it for proteasomal degradation concomitantly with downstream signaling.
22607805 14-3-3epsilon is essential for the stable interaction of RIG-I with TRIM25, which facilitates RIG-I ubiquitination and initiation of innate immunity against hepatitis C virus and other pathogenic RNA viruses.
22452784 EFP mediates estrogen-induced ATBF1 protein degradation in breast cancer cells.
More...

AA Sequence

MAELCPLAEELSCSICLEPFKEPVTTPCGHNFCGSCLNETWAVQGSPYLCPQCRAVYQARPQLHKNTVLC      1 - 70
NVVEQFLQADLAREPPADVWTPPARASAPSPNAQVACDHCLKEAAVKTCLVCMASFCQEHLQPHFDSPAF     71 - 140
QDHPLQPPVRDLLRRKCSQHNRLREFFCPEHSECICHICLVEHKTCSPASLSQASADLEATLRHKLTVMY    141 - 210
SQINGASRALDDVRNRQQDVRMTANRKVEQLQQEYTEMKALLDASETTSTRKIKEEEKRVNSKFDTIYQI    211 - 280
LLKKKSEIQTLKEEIEQSLTKRDEFEFLEKASKLRGISTKPVYIPEVELNHKLIKGIHQSTIDLKNELKQ    281 - 350
CIGRLQEPTPSSGDPGEHDPASTHKSTRPVKKVSKEEKKSKKPPPVPALPSKLPTFGAPEQLVDLKQAGL    351 - 420
EAAAKATSSHPNSTSLKAKVLETFLAKSRPELLEYYIKVILDYNTAHNKVALSECYTVASVAEMPQNYRP    421 - 490
HPQRFTYCSQVLGLHCYKKGIHYWEVELQKNNFCGVGICYGSMNRQGPESRLGRNSASWCVEWFNTKISA    491 - 560
WHNNVEKTLPSTKATRVGVLLNCDHGFVIFFAVADKVHLMYKFRVDFTEALYPAFWVFSAGATLSICSPK    561 - 630
//

Text Mined References (59)

PMID Year Title
26299329 2015 Regulation of MDA5-MAVS Antiviral Signaling Axis by TRIM25 through TRAF6-Mediated NF-?B Activation.
26138103 2015 Dengue subgenomic RNA binds TRIM25 to inhibit interferon expression for epidemiological fitness.
25728675 2015 TRIM25 has a dual function in the p53/Mdm2 circuit.
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
25457611 2014 Trim25 Is an RNA-Specific Activator of Lin28a/TuT4-Mediated Uridylation.
24810856 2014 Polyubiquitylation of AMF requires cooperation between the gp78 and TRIM25 ubiquitin ligases.
24478431 2014 Hijacking of RIG-I signaling proteins into virus-induced cytoplasmic structures correlates with the inhibition of type I interferon responses.
24399297 2014 The ubiquitin-specific protease USP15 promotes RIG-I-mediated antiviral signaling by deubiquitylating TRIM25.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24131985 2013 Expression levels of the innate response gene RIG-I and its regulators RNF125 and TRIM25 in HIV-1-infected adult and pediatric individuals.
More...