Property Summary

NCBI Gene PubMed Count 49
PubMed Score 213.62
PubTator Score 56.43

Knowledge Summary

Patent

No data available

Expression

Gene RIF (27)

PMID Text
26299329 TRIM25 plays an additional role in RIG-I/MDA5 signaling other than RIG-I ubiquitination via activation of NF-kappaB.
26138103 The PR-2B DENV-2 produced increased levels of subgenomic flavivirus RNA (sfRNA) relative to genomic RNA during replication. PR-2B sfRNA showed sequence dependent binding to and prevention of tripartite motif 25 (TRIM25) deubiquitylation, which is critical for sustained and amplified retinoic acid-inducible gene 1 (RIG-I)-induced type I interferon expression.
25728675 Data show that TRIM25 enhances p53 and Mdm2 abundance by preventing their proteasomal degradation. At the same time, TRIM25 inhibits p53's transcriptional activity and dampens the response to DNA damage.
25457611 Trim25 binds to the conserved terminal loop (CTL) of pre-let-7 and activates TuT4, allowing for more efficient Lin28a-mediated uridylation.
24810856 Our data uncovers a previously unknown functional link between gp78 and TRIM25 and provides mechanistic insight into gp78-mediated protein ubiquitylation.
24399297 Data indicate ubiquitin-specific protease 15 (USP15) as a critical regulator of the tripartite motif protein 25 (TRIM25)- and RNA sensor retinoic acid-inducible gene-I (RIG-I)-mediated antiviral immune response
24131985 In controls, RNF125 is the highest expressed gene, whereas in HIV infection progressors, RIG-I is either the highest expressed gene or is expressed similarly to RNF125 and TRIM25.
22626058 Study reports that RLR activation triggers MAVS ubiquitination on lysine 7 and 10 by the E3 ubiquitin ligase TRIM25 and marks it for proteasomal degradation concomitantly with downstream signaling.
22607805 14-3-3epsilon is essential for the stable interaction of RIG-I with TRIM25, which facilitates RIG-I ubiquitination and initiation of innate immunity against hepatitis C virus and other pathogenic RNA viruses.
22452784 EFP mediates estrogen-induced ATBF1 protein degradation in breast cancer cells.
22082156 Knockdown of tripartite motif containing 25 (TRIM25) by siRNA enhances the early stages of HIV-1 replication in HeLa-CD4 cells infected with viral pseudotypes HIV89.6R and HIV8.2N
21890623 Studies indicate that the splice variant of RIG-I encodes a protein that lacks the first CARD of RIG-I, and the variant RIG-I protein is not ubiquitinated by TRIM25.
21292167 RING-IBR-RING E3 ligase domains of HOIL-1L and HOIP bind and induce proteasomal degradation of TRIM25, whereas the NZF domain of HOIL-1L competes with TRIM25 for RIG-I binding
21266548 Molecular basis for ubiquitin and ISG15 cross-reactivity in viral ovarian tumor domains.
20546612 Observational study of gene-disease association. (HuGE Navigator)
20127022 The regulation of Efp and bFGF expression during endometrial carcinogenesis suggests their potential utility as a prognostic biomarker.
19454348 NS1 inhibits TRIM25-mediated RIG-I ubiquitination, thereby suppressing RIG-I signal transduction.
19454344 Viral nonstructural protein 1 inhibits activation of RIG-I by binding to TRIM25.
19148513 estradiol and tamoxifen may regulate the growth of endometrial carcinoma cells by stimulating VEGF production through Efp.
18948594 role of the intact tandem CARD for TRIM25-mediated RIG-I activation; TRIM25 binds the RIG-I first CARD and subsequently ubiquitinates its second CARD
18248090 Gene silencing of endogenously expressed TRIM 25 inhibits viral release, suggesting the interaction between HIV-1 Gag and TRIM25
17418098 Our results indicate that EFP functions as a cofactor for ERalpha-mediated transcription.
17069755 Efp is an IFN-responsive gene that potentially mediates IFN actions, involved in ISGylation and ubiquitination of proteins including Efp itself.
16271083 14-3-3 sigma expression inversely correlated with estrogen receptor alpha, progesterone receptor and estrogen-responsive finger protein, and positively correlated with myometrial invasion and lymph node metastasis in endometrial adenocarcinoma
16144914 Over expression of Estrogen-responsive finger protein is associated with tumor progression of breast carcinoma
15130519 Results indicate that estrogen-responsive finger protein is widely expressed and may play important roles in various human tissues, possibly through estrogen receptors.
12943693 Efp controls breast cancer growth through ubiquitin-dependent proteolysis of 14-3-3sigma.

AA Sequence

MAELCPLAEELSCSICLEPFKEPVTTPCGHNFCGSCLNETWAVQGSPYLCPQCRAVYQARPQLHKNTVLC      1 - 70
NVVEQFLQADLAREPPADVWTPPARASAPSPNAQVACDHCLKEAAVKTCLVCMASFCQEHLQPHFDSPAF     71 - 140
QDHPLQPPVRDLLRRKCSQHNRLREFFCPEHSECICHICLVEHKTCSPASLSQASADLEATLRHKLTVMY    141 - 210
SQINGASRALDDVRNRQQDVRMTANRKVEQLQQEYTEMKALLDASETTSTRKIKEEEKRVNSKFDTIYQI    211 - 280
LLKKKSEIQTLKEEIEQSLTKRDEFEFLEKASKLRGISTKPVYIPEVELNHKLIKGIHQSTIDLKNELKQ    281 - 350
CIGRLQEPTPSSGDPGEHDPASTHKSTRPVKKVSKEEKKSKKPPPVPALPSKLPTFGAPEQLVDLKQAGL    351 - 420
EAAAKATSSHPNSTSLKAKVLETFLAKSRPELLEYYIKVILDYNTAHNKVALSECYTVASVAEMPQNYRP    421 - 490
HPQRFTYCSQVLGLHCYKKGIHYWEVELQKNNFCGVGICYGSMNRQGPESRLGRNSASWCVEWFNTKISA    491 - 560
WHNNVEKTLPSTKATRVGVLLNCDHGFVIFFAVADKVHLMYKFRVDFTEALYPAFWVFSAGATLSICSPK    561 - 630
//

Text Mined References (59)

PMID Year Title
26299329 2015 Regulation of MDA5-MAVS Antiviral Signaling Axis by TRIM25 through TRAF6-Mediated NF-?B Activation.
26138103 2015 Dengue subgenomic RNA binds TRIM25 to inhibit interferon expression for epidemiological fitness.
25728675 2015 TRIM25 has a dual function in the p53/Mdm2 circuit.
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
25457611 2014 Trim25 Is an RNA-Specific Activator of Lin28a/TuT4-Mediated Uridylation.
24810856 2014 Polyubiquitylation of AMF requires cooperation between the gp78 and TRIM25 ubiquitin ligases.
24478431 2014 Hijacking of RIG-I signaling proteins into virus-induced cytoplasmic structures correlates with the inhibition of type I interferon responses.
24399297 2014 The ubiquitin-specific protease USP15 promotes RIG-I-mediated antiviral signaling by deubiquitylating TRIM25.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24131985 2013 Expression levels of the innate response gene RIG-I and its regulators RNF125 and TRIM25 in HIV-1-infected adult and pediatric individuals.
23974796 2013 Identification of a long non-coding RNA-associated RNP complex regulating metastasis at the translational step.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23077300 2013 TRIM protein-mediated regulation of inflammatory and innate immune signaling and its association with antiretroviral activity.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
22626058 2012 MAVS ubiquitination by the E3 ligase TRIM25 and degradation by the proteasome is involved in type I interferon production after activation of the antiviral RIG-I-like receptors.
22607805 2012 The mitochondrial targeting chaperone 14-3-3? regulates a RIG-I translocon that mediates membrane association and innate antiviral immunity.
22452784 2012 Oestrogen causes ATBF1 protein degradation through the oestrogen-responsive E3 ubiquitin ligase EFP.
21890623 2012 Ubiquitin-mediated modulation of the cytoplasmic viral RNA sensor RIG-I.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21292167 2011 Linear ubiquitin assembly complex negatively regulates RIG-I- and TRIM25-mediated type I interferon induction.
21269460 2011 Initial characterization of the human central proteome.
21266548 2011 Molecular basis for ubiquitin and ISG15 cross-reactivity in viral ovarian tumor domains.
20818395 2010 Caspase-12 controls West Nile virus infection via the viral RNA receptor RIG-I.
20546612 2010 The role of height-associated loci identified in genome wide association studies in the determination of pediatric stature.
20127022 2010 Expression of Efp, VEGF and bFGF in normal, hyperplastic and malignant endometrial tissue.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19484123 2009 REUL is a novel E3 ubiquitin ligase and stimulator of retinoic-acid-inducible gene-I.
19454348 2009 Influenza A virus NS1 targets the ubiquitin ligase TRIM25 to evade recognition by the host viral RNA sensor RIG-I.
19454344 2009 Influenza A virus TRIMs the type I interferon response.
19148513 2009 Regulation of the vascular endothelial growth factor and growth by estrogen and antiestrogens through Efp in Ishikawa endometrial carcinoma cells.
19017631 2009 Riplet/RNF135, a RING finger protein, ubiquitinates RIG-I to promote interferon-beta induction during the early phase of viral infection.
18948594 2008 Roles of RIG-I N-terminal tandem CARD and splice variant in TRIM25-mediated antiviral signal transduction.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18391951 2008 Many sequence variants affecting diversity of adult human height.
18248090 2008 TRIM E3 ligases interfere with early and late stages of the retroviral life cycle.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17418098 2007 Ligand-dependent transcription of estrogen receptor alpha is mediated by the ubiquitin ligase EFP.
17392790 2007 TRIM25 RING-finger E3 ubiquitin ligase is essential for RIG-I-mediated antiviral activity.
17222803 2007 Negative regulation of ISG15 E3 ligase EFP through its autoISGylation.
17069755 2006 A ubiquitin E3 ligase Efp is up-regulated by interferons and conjugated with ISG15.
16625196 2006 DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage.
16352599 2006 The interferon-inducible ubiquitin-protein isopeptide ligase (E3) EFP also functions as an ISG15 E3 ligase.
16271083 2005 Increasing 14-3-3 sigma expression with declining estrogen receptor alpha and estrogen-responsive finger protein expression defines malignant progression of endometrial carcinoma.
16144914 2005 Estrogen-responsive finger protein as a new potential biomarker for breast cancer.
16127453 2005 IPS-1, an adaptor triggering RIG-I- and Mda5-mediated type I interferon induction.
15592455 2005 Immunoaffinity profiling of tyrosine phosphorylation in cancer cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15130519 2004 Systemic distribution of estrogen-responsive finger protein (Efp) in human tissues.
12943693 2003 Estrogen-responsive RING finger protein controls breast cancer growth.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12075357 2002 Efp targets 14-3-3 sigma for proteolysis and promotes breast tumour growth.
11331580 2001 The tripartite motif family identifies cell compartments.
11002417 2000 Activation of the NF-kappaB pathway by caspase 8 and its homologs.
10781795 2000 Efp as a primary estrogen-responsive gene in human breast cancer.
9245730 1997 Multiple regulatory elements and binding proteins of the 5'-flanking region of the human estrogen-responsive finger protein (efp) gene.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8248217 1993 Genomic binding-site cloning reveals an estrogen-responsive gene that encodes a RING finger protein.
7789997 1995 Chromosome mapping of human (ZNF147) and mouse genes for estrogen-responsive finger protein (efp), a member of the RING finger family.