Property Summary

NCBI Gene PubMed Count 17
PubMed Score 14.76
PubTator Score 22.89

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
pituitary cancer 1972 1.38440660172334E-6
medulloblastoma 1524 2.23708409879297E-6
ovarian cancer 8492 5.63894821452589E-6
lung adenocarcinoma 2714 5.17582478838021E-5
osteosarcoma 7933 8.91978991945248E-5
lung cancer 4473 9.18938670443389E-5
nasopharyngeal carcinoma 1056 3.17678739074173E-4
Parkinson's disease 364 0.00157448491253947
Multiple myeloma 1328 0.00170517284554928
Breast cancer 3099 0.0250450794678322
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.0352949632839914
Disease Target Count Z-score Confidence
Anogenital venereal wart 8 4.016 2.0

Expression

  Differential Expression (11)

Disease log2 FC p
Multiple myeloma 1.699 0.002
osteosarcoma 2.398 0.000
medulloblastoma 1.100 0.000
intraductal papillary-mucinous carcinoma... 1.200 0.035
lung cancer 2.100 0.000
Parkinson's disease -1.500 0.002
Breast cancer 3.600 0.025
nasopharyngeal carcinoma 1.200 0.000
lung adenocarcinoma 1.287 0.000
ovarian cancer 2.800 0.000
pituitary cancer -1.100 0.000

Synonym

Accession Q14257 A8MTG6 F8WCY5 Q53XN8
Symbols E6BP
ERC55
ERC-55
TCBP49

Gene

  Ortholog (11)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG Inparanoid
Opossum EggNOG Inparanoid
Platypus OMA EggNOG
Xenopus OMA EggNOG Inparanoid
C. elegans OMA EggNOG

Gene RIF (4)

PMID Text
22190034 HIV-1 gp120 is identified to have a physical interaction with reticulocalbin 2, EF-hand calcium binding domain (RCN2) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
21044367 Observational study of gene-disease association. (HuGE Navigator)
19927312 Confirmed is the existence of several ERC-55 splicing variants including ERC-55-C localized in the cytosol in association with the cytoskeleton.
18435749 RCN2 is implicated in idiopathic absence epilepsy.

AA Sequence

MRLGPRTAALGLLLLCAAAAGAGKAEELHYPLGERRSDYDREALLGVQEDVDEYVKLGHEEQQKRLQAII      1 - 70
KKIDLDSDGFLTESELSSWIQMSFKHYAMQEAKQQFVEYDKNSDDTVTWDEYNIQMYDRVIDFDENTALD     71 - 140
DAEEESFRKLHLKDKKRFEKANQDSGPGLSLEEFIAFEHPEEVDYMTEFVIQEALEEHDKNGDGFVSLEE    141 - 210
FLGDYRWDPTANEDPEWILVEKDRFVNDYDKDNDGRLDPQELLPWVVPNNQGIAQEEALHLIDEMDLNGD    211 - 280
KKLSEEEILENPDLFLTSEATDYGRQLHDDYFYHDEL                                     281 - 317
//

Text Mined References (21)

PMID Year Title
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21900206 2011 A directed protein interaction network for investigating intracellular signal transduction.
21269460 2011 Initial characterization of the human central proteome.
21044367 2010 An integrative method for scoring candidate genes from association studies: application to warfarin dosing.
20562859 2010 Network organization of the human autophagy system.
19927312 2009 Identification and characterization of novel ERC-55 interacting proteins: evidence for the existence of several ERC-55 splicing variants; including the cytosolic ERC-55-C.
18435749 2008 Gene expression analysis in absence epilepsy using a monozygotic twin design.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
More...