Property Summary

NCBI Gene PubMed Count 17
Grant Count 26
R01 Count 22
Funding $1,884,338.67
PubMed Score 14.76
PubTator Score 22.89

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
Multiple myeloma 1.699 0.002
osteosarcoma 2.398 0.000
medulloblastoma 1.100 0.000
intraductal papillary-mucinous carcinoma... 1.200 0.035
lung cancer 2.100 0.000
Parkinson's disease -1.500 0.002
Breast cancer 3.600 0.025
nasopharyngeal carcinoma 1.200 0.000
lung adenocarcinoma 1.287 0.000
ovarian cancer 2.800 0.000
pituitary cancer -1.100 0.000

Gene RIF (4)

PMID Text
22190034 HIV-1 gp120 is identified to have a physical interaction with reticulocalbin 2, EF-hand calcium binding domain (RCN2) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
21044367 Observational study of gene-disease association. (HuGE Navigator)
19927312 Confirmed is the existence of several ERC-55 splicing variants including ERC-55-C localized in the cytosol in association with the cytoskeleton.
18435749 RCN2 is implicated in idiopathic absence epilepsy.

AA Sequence

MRLGPRTAALGLLLLCAAAAGAGKAEELHYPLGERRSDYDREALLGVQEDVDEYVKLGHEEQQKRLQAII      1 - 70
KKIDLDSDGFLTESELSSWIQMSFKHYAMQEAKQQFVEYDKNSDDTVTWDEYNIQMYDRVIDFDENTALD     71 - 140
DAEEESFRKLHLKDKKRFEKANQDSGPGLSLEEFIAFEHPEEVDYMTEFVIQEALEEHDKNGDGFVSLEE    141 - 210
FLGDYRWDPTANEDPEWILVEKDRFVNDYDKDNDGRLDPQELLPWVVPNNQGIAQEEALHLIDEMDLNGD    211 - 280
KKLSEEEILENPDLFLTSEATDYGRQLHDDYFYHDEL                                     281 - 317
//

Text Mined References (21)

PMID Year Title
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21900206 2011 A directed protein interaction network for investigating intracellular signal transduction.
21269460 2011 Initial characterization of the human central proteome.
21044367 2010 An integrative method for scoring candidate genes from association studies: application to warfarin dosing.
20562859 2010 Network organization of the human autophagy system.
19927312 2009 Identification and characterization of novel ERC-55 interacting proteins: evidence for the existence of several ERC-55 splicing variants; including the cytosolic ERC-55-C.
18435749 2008 Gene expression analysis in absence epilepsy using a monozygotic twin design.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
More...